Jump to content
×
×
  • Create New...

Overfall2 Server Files Leaked


Recommended Posts

  • Contributeur

Centre de Téléchargement

Télécharger ( Source )
Télécharger ( Unpacked Client )

Les files & sources du serveur Overfall2 ont été leak... 🙃

Révélation

overfall2-adv.gif
overfall2-logo.png
leak-00-logo.gif
leak-01-1.png
leak-02-2.png
leak-03.png
leak-04.gif
leak-05.gif
leak-06.gif
leak-08.png
leak-11-1.png
leak-07-03.gif
leak-09.gif
leak-10-1.png
leak-10-2.png
leak-10-3.png
leak-10-4.png
leak-11-2.gif
leak-12.gif
leak-13.png
leak-15.png
leak-17-1.png
leak-17-2.png
leak-18-1.gif
leak-19-2.gif
leak-19-3.gif
leak-20-1.png
leak-20-2.gif
leak-21.gif
leak-22-1.png
leak-22-2.png
leak-23.gif
leak-24-1.gif
leak-24-2.gif
leak-24-3.gif

Révélation
#ifndef __INC_SERVICE_H__
#define __INC_SERVICE_H__

#define OVERFALL2_VERSION 27

#define _IMPROVED_PACKET_ENCRYPTION_
#define __PET_SYSTEM__
#define __UDP_BLOCK__

/// SEQ.RE
#define __DISABLE_SEND_SEQUENCE__
#define __FIX_PRO_DAMAGE__
/// /// /// /// /// /// /// /// /// ///

/// OSP_WORK
#define __SWAP_ITEM_SYSTEM__ // Swap items between inventory slots
#define __SORT_INVENTORY_ITEMS__ // Sorts all inventory items
#define __ITEM_DROP_RENEWAL__ // Item drop renewal
#define __INVENTORY_4PAGES__ // 4 inventory pages
#define __SPECIAL_INVENTORY_SYSTEM__ // Special inventory
#ifdef __SPECIAL_INVENTORY_SYSTEM__
	#define ENABLE_EXTEND_SPECIAL_INVEN_SYSTEM
#endif
#define __MINI_GAME_OKEY__ // Mini game okey/runi
#define __MINI_GAME_CATCH_KING__ // Mini game catch king
#define __SEND_TARGET_INFO__ // Monster target information
#define __SEND_TARGET_ELEMENT__ // Target element
#define __7AND8TH_SKILLS__ // 7 and 8th skill
#define __NEW_BLEND_AFFECT__ // New blend affect
#define __12ZI_NOTICE__ // 12ZI mission notice
#define __NEW_DROP_DIALOG__ // New drop dialog with remove item option
#define __GUILD_LEADER_GRADE_NAME__ // Shows guild leader grade name on text tail
#define __MESSENGER_BLOCK_SYSTEM__ // Messenger block list
#define __MESSENGER_GM__ // Messenger gm list
#define __QUIVER_SYSTEM__ // Ninja quiver
#define __IGNORE_LOW_POWER_BUFF__ // Ignore low power buff
#define __CHANGE_LOOK_SYSTEM__ // Change look of item
#define __HIDE_COSTUME_SYSTEM__ // Hide costume part
#define __OFFLINE_PRIVATE_SHOP_SYSTEM__ // Offline private shop
#ifdef __OFFLINE_PRIVATE_SHOP_SYSTEM__
#define __OFFLINE_SHOP_PID_MAP_GUESTS__ //Use pid for save informations about guest players
#endif
#define __DUNGEON_INFO_SYSTEM__ // Dungeons informations
#define __GENDER_ALIGNMENT__ // Gender alignment
#define __REFINE_FAIL_TYPE__ // Extended refine fail message
#define __GACHA_SYSTEM__ // Gacha boxes (x use time)
#define __ELEMENT_SYSTEM__ // Elements of monsters and pendants
#define __PENDANT_SYSTEM__ // Talismans of elements
#ifdef __PENDANT_SYSTEM__
	#define __PENDANT_ATT_LIMIT__ // Limit attributes on pendant
#endif
#define __EXTENDED_ITEM_AWARD__ // Extended item award
#define __GROWTH_PET_SYSTEM__ // Growth pet system
#define __SPECIAL_PVP_DUEL_OPTION__ // Special PvP duel with arguments (without critcal, penetration, posion and others...)
#define __FLAG_IMAGE_SHOUT_LINE__ // Display's kingdoom flag in shout line
#define __SOUL_BIND_SYSTEM__ // Soul bind items
#define __QUEST_RENEWAL__ // Quest renewal with categories
#define __AUTO_BLEND_AFFECT__ // Auto blend item affect
#define __BUFFER_SYSTEM__ // Personal Shaman buffer (supporter)
#define __ANTI_EXP_RING__ // Anti experience ring
#define __MOVE_CHANNEL__ // Move channel system
#define __MAILBOX_SYSTEM__ // Mail box system
#define __SHOPEX_RENEWAL__ // ShopEX renewal
#ifdef __SHOPEX_RENEWAL__
#define __SHOPEX_TAB4__ // ShopEX 4 tabs
#endif
#define __SOUL_SYSTEM__ // Soul system
#define __SKILL_COLOR_SYSTEM__ // Skill color system
#define __DS_GRADE_MYTH__ // Dragon soul mythical grade
#define __PRIVATE_SHOP_SEARCH_SYSTEM__ // Search private shop items
#ifdef __PRIVATE_SHOP_SEARCH_SYSTEM__
	#define __PRIVATE_SHOP_SEARCH_NEED_ITEM__ // Require special search item
#endif
#define __EXTENDED_DSS_RECHARGE__ // Dragon soul extended recharge
#define __EXTENDED_ITEM_COUNT__ // Extend the amount of items
#define __ITEM_SOCKET5__ // Extend item sockets
#define __EXTENDED_BLEND__ // Extened blend affect
#define __STONE_OF_BLESS__ // New refine item
#define __DICE_SYSTEM__ // New dice system
#define __DS_SET__ // Dragon soul handle bonus
#define __MULTI_LANGUAGE_SYSTEM__ // Multi language system
#if defined(__MULTI_LANGUAGE_SYSTEM__)
	#define __REMOVE_MULTI_LANGUAGE_SYSTEM__
#endif
#define _IMPROVED_LOGOUT_POINTS_ // Improved update packet on logout
/// /// /// /// /// /// /// /// /// ///

/// WJ_WORK
#define __WJ_SHOW_MOB_INFO__ // Show monster aggregate flag and level
#define __WJ_PICKUP_ITEM_EFFECT__ // Pickup item effect
/// /// /// /// /// /// /// /// /// ///

/// COSTUME_SYSTEM
#define __MOUNT_COSTUME_SYSTEM__ // Mount costume system
#define __ACCE_COSTUME_SYSTEM__ // Sash costume system
#define __WEAPON_COSTUME_SYSTEM__ // Weapon costume system
#define __COSTUME_ATTR_SYSTEM__ // Costume attribute switchers
/// /// /// /// /// /// /// /// /// ///

/// OVERFALL2 WORK
#if defined(__SPECIAL_INVENTORY_SYSTEM__)
#define __RENEWAL_SAFEBOX_MALL__ //Open safebox in special inventory
#endif
#define __GEM_AND_RED_GEM_SYSTEM__ // Gaya and blue gaya
#define __NEW_PRIVATE_SHOP_SEARCH_SYSTEM__ // new private shop search
#define __ENABLE_PREMIUM_MEMBERS__ //premium members system
#define ENABLE_SWITCHBOT //switchbot
#define __NEW_REGIST_PLAYER_INFO__ //Quantida de players mortos, monstros etc
#define RENEWAL_DEAD_PACKET
#define ENABLE_NEW_GYEONGGONG_SKILL //Ponto explusivo na rapidez do ninja arco
#define __NEW_PASSIVE_SKILLS__
#define __NEW_ECLIPSE_ELIXER__
#ifdef __EXTENDED_ITEM_AWARD__
	#define USE_ITEM_AWARD_CHECK_ATTRIBUTES // c++11 or higher
#endif
#define __ENABLE_REWORK_SHOP_QUEST__
#define __DRAGON_SOUL_RENEW__ //Drop das lascas nas metins, etc
#define ENABLE_CUBE_RENEWAL
#define ENABLE_EXTEND_INVEN_SYSTEM
#define ENABLE_MAINTENANCE_SYSTEM
#define __NEW_EXCHANGE_WINDOW__
#define __PLAYER_PER_ACCOUNT5__ // Enable 5 players per account
#define __TRADE_BONUS_COSTUME__
#define ENABLE_ANTI_MULTIPLE_FARM
#define __NEW_LOGS__
#define __ENABLE_VALENTINE_EVENT__
/// /// /// /// /// /// /// /// /// ///

/// ###Dungeons
#define __TEMPLE_OCHAO__ // Temple of the Ochao
#ifdef __TEMPLE_OCHAO__
	#define TEMPLE_OCHAO_MAP_INDEX 353
	#define TEMPLE_OCHAO_GUARDIAN 6405
	#define TEMPLE_OCHAO_PORTAL 20415
#endif

#define __EREBUS_DUNGEON__ // Erebus dungeon
#ifdef __EREBUS_DUNGEON__
	#define EREBUS_FINAL_BOSS 6192
	#define EREBUS_HEALER 6409
#endif

#define __GUILD_DRAGONLAIR_PARTY_SYSTEM__ // Guild dragon lair party system
#ifdef __GUILD_DRAGONLAIR_PARTY_SYSTEM__
	#define __GUILD_DRAGONLAIR__ // Guild dragon lair dungeon
	#ifdef __GUILD_DRAGONLAIR__
		#define GUILD_DRAGONLAIR_DESTROY_STATUE_GM
		#define GUILD_DRAGONLAIR_LAZER_EFFECT_75HP
		#define GUILD_DRAGONLAIR_LAZER_EFFECT_50HP
	#endif
#endif
/// /// /// /// /// /// /// /// /// ///

/// ###Removed systems
// #define __GPET_CACHE_SYS__ // Caching for Growth Pet System

// #define __USE_SINGLE_ADD_ATTRIBUTE__ // Use single add attribute

// #define __WARP_TO_VILLAGE_HOT_KEY__ // Warp to village

// #define __CHEQUE_SYSTEM__ // Won

// #define __GEM_SYSTEM__ // Gem
// #if defined(__GEM_SYSTEM__)
	// #define __GEM_MARKET_SYSTEM__ // Gem Market
// #endif

// #define __TOKEN_CURRENCY__ // Token (Remove)
// #define __EXPRESSING_EMOTIONS__ // Special actions & emotions
// #define __EXTENDED_COSTUME_RECHARGE__ // Costume extended recharge
/// /// /// /// /// /// /// /// /// ///
#endif

 

Révélation
#define LOCALE_SERVICE_SINGAPORE
#define ENABLE_COSTUME_SYSTEM
#define ENABLE_ENERGY_SYSTEM
#define ENABLE_DRAGON_SOUL_SYSTEM
#define ENABLE_NEW_EQUIPMENT_SYSTEM

#define __USE_CYTHON__

#define VERSION 1000
#define OVERFALL2_VERSION 27

/// Login UI ------------------------
// Server Select Renewal (08.09.2018)
#define ENABLE_SERVER_SELECT_RENEWAL
#define ENABLE_CHANNEL_LIST
#define LOGIN_COUNT_DOWN_UI_MODIFY
/// ---------------------------------

/// OSP.TMP_WORK
#define ENABLE_PARTY_CHALLENGE_SYSTEM // Party challenge
#define ENABLE_SECONDARY_ACCE_COSTUME_SYSTEM // Acce costume
/// /// /// /// /// /// /// /// /// ///

/// OSP.WORK
#define ENABLE_678TH_SKILL // New 678th skills
#define ENABLE_MINI_GAME_OKEY // Mini game rumi (okey)
#define ENABLE_MINI_GAME_CATCH_KING // Mini game catch king
#define ENABLE_EXTEND_INVEN_SYSTEM // Extended inventory pages (4)
#define ENABLE_ENVIRONMENT_EFFECT_OPTION // Environment options
#define ENABLE_TAB_NEXT_TARGET // Enable next target on key tab
#define ENABLE_ITEM_DROP_RENEWAL // Renewal of item drops with color effect
#define ENABLE_SEND_TARGET_INFO // Monsters information
#define ENABLE_OFFLINE_SHOP_SYSTEM // Offline private shop
#define ENABLE_SPECIAL_INVENTORY_SYSTEM // Special inventory
#ifdef ENABLE_SPECIAL_INVENTORY_SYSTEM
	#define ENABLE_EXTEND_SPECIAL_INVEN_SYSTEM
#endif
#define ENABLE_AUTO_REFINE // Auto refinement option
#define ENABLE_NEW_BLEND_AFFECT // New blend affects with icon
#define ENABLE_AFK_SYSTEM // Away from keyboard monetizing
#define ENABLE_12ZI // 12ZI mission notice (without dungeon)
#define ENABLE_DUNGEON_INFO_SYSTEM // Dungeon informations
#define ENABLE_GENDER_ALIGNMENT // Gender alignment (m, f)
#define ENABLE_NEW_DROP_DIALOG // New drop dialog with remove item option
#define ENABLE_GUILD_LEADER_GRADE_NAME // Shows guild leader grade name on text tail
#define ENABLE_MESSENGER_GM // Messenger gm list
#define ENABLE_MESSENGER_BLOCK // Messenger block
#define ENABLE_QUIVER_SYSTEM // Quiver
#define ENABLE_NEW_USER_CARE // User care
#define ENABLE_SWAP_SLOT_SYSTEM // Swap item slot
#define ENABLE_CHANGE_LOOK_SYSTEM // Change look of item
#define ENABLE_HIDE_COSTUME_SYSTEM // Hide costume parts
#define ENABLE_REFINE_FAIL_TYPE // Extended refine fail message
#define ENABLE_GACHA // ENABLE_BOSS_BOX Gacha boxes (x use time)
#define ENABLE_ELEMENT_ADD // Monsters element
#define ENABLE_TEXT_IMAGE_LINE // Image in text line
#define ENABLE_PENDANT // Talismans of elements
#define ENABLE_GROWTH_PET_SYSTEM // Growth pet system w/ item type
#define ENABLE_IMAGE_SCALE // Image box scaling
#define ENABLE_SWITCH_BOT // Switch bot
#define ENABLE_SPECIAL_PVP_DUEL_OPTION // Special PvP duel with arguments (without critcal, penetration, posion and others...)
#define ENABLE_EMOTION_HIDE_WEAPON // Hide weapon while acting emotions
#define ENABLE_LOADING_TIP // Show loading tip
#define ENABLE_SOUL_BIND_SYSTEM // Soul bind items
#define ENABLE_QUEST_RENEWAL // Quest page renewal
#define ENABLE_DISABLE_SOFTWARE_TILING // Disable software tiling
#define ENABLE_GRAPHIC_ON_OFF // System graphic options
#define ENABLE_EXTENDED_BLEND_AFFECT // Extended blend item affect
#define ENABLE_BUFFER_SYSTEM // Personal Shaman buffer (supporter)
#define ENABLE_MOVE_CHANNEL // Move game channel
#define ENABLE_MAILBOX_SYSTEM // Mail box system
#define ENABLE_GUI_SELECT // Select alternative GUI
#define ENABLE_QUICK_PICKUP // Fast pickup close items
#define ENABLE_SHOPEX_RENEWAL // ShopEX renewal
#define ENABLE_SOUL_SYSTEM // Soul system
#define ENABLE_SKILL_COLOR_SYSTEM // Skill color
#define ENABLE_DS_GRADE_MYTH // Dragon soul mythical grade
#define ENABLE_PRIVATE_SHOP_SEARCH_SYSTEM // Private shop search
#define ENABLE_DSS_ACTIVE_EFFECT_BUTTON // Dragon soul active effect button
#define ENABLE_DSS_EXTENDED_RECHARGE // Dragon soul extended recharge
#define ENABLE_EXTENDED_ITEM_COUNT // Extend the amount of items
#define ENABLE_ITEM_SOCKET5 // Extend item sockets
#define ENABLE_STONE_OF_BLESS // Stone of bless (refinement item)
#define ENABLE_DICE_SYSTEM // New dice system
#define ENABLE_DS_SET // Dragon soul table handling
#define ENABLE_MULTI_LANGUAGE_SYSTEM // Multi language system
#if defined(ENABLE_MULTI_LANGUAGE_SYSTEM)
	/*brief: Remove only visual part of multi language;
			The default language are setuped in Locale.cpp (void LocaleService_LoadConfig(const char* fileName))
	*/
	#define REMOVE_MULTI_LANGUAGE_SYSTEM
#endif
/// /// /// /// /// /// /// /// /// ///
#define ENABLE_LOAD_PROPERTY
/// WJ_WORK
#define WJ_NEW_USER_CARE // Save user options
#define WJ_SHOW_MOB_INFO // Show monsters level & aggressive flag
#define WJ_ENABLE_PICKUP_ITEM_EFFECT // Pickup item effect
#define WJ_ENABLE_TRADABLE_ICON // Block un-tradable items
#define WJ_MULTI_TEXTLINE // Multi textline
/// /// /// /// /// /// /// /// /// ///

/// Costume Systems
#define ENABLE_MOUNT_COSTUME_SYSTEM // Mount costume
#define ENABLE_ACCE_COSTUME_SYSTEM // Acce costume
#define ENABLE_WEAPON_COSTUME_SYSTEM // Weapon costume
#define ENABLE_COSTUME_ATTR_SYSTEM // Costume attributes
/// /// /// /// /// /// /// /// /// ///

/// Fixes & Others
#define ENABLE_FOG_FIX // Fog fix for new environment effect
#define ENABLE_EFFECT_CAMERA_VIEW_FIX // Effect camera view fix
#define REMOVE_SAFEZONE_COLLISION // Remove npc collision in safe zone.
#define REMOVE_SHOP_COLLISION // Remove shop collision
#define REMOVE_HORSE_COLLISION // Remove horse collision
#define REMOVE_PET_COLLISION // Remove pet collision
#define REMOVE_MOUNT_COLLISION // Remove mount collision
#define REMOVE_OX_PLAYER_COLLISION // Remove player collision in ox event map
#define DISABLE_SEND_SEQUENCE // Disable send sequence
#define DISABLE_INDEX_FILE // Disable index file from client
// #define ENABLE_MD5_FILE_CHECK // Enable MD5 file check from client
#define ENABLE_ETER_PACK_OBSCURING // Enable EterPack key obscuring (hide heys from binary)
#define ENABLE_CONFIG_MODULE // Enable configuration module for saving settings
#define ENABLE_IMPROVED_LOGOUT_POINTS // Enable improved logout points which shows the last player status points and parts on intro select
#define _DOUBLE_RECV_BUFFER_
#define ENABLE_PINGTIME //Enable ping trace
#define LIMIT_WINDOWS_RECT //Enable limit rect movable windows 
#define ENABLE_BADGE_NOTIFICATION_MANAGER //Badge notification
#define ENABLE_EXPRESSING_EMOTION_RENEW // Special actions
#define ENABLE_MAP_PERFORMANCE
/// /// /// /// /// /// /// /// /// ///


/// ###Overfall2 - Work
#define ENABLE_NEW_PRIVATE_SHOP_SEARCH_SYSTEM // new private shop search
#define ENABLE_PREMIUM_MEMBERS //enable overfall premium members
#define ENABLE_SWITCHBOT //switchbot system
#define ENABLE_NEW_REGIST_PLAYER_INFO //Monster killed etc info
#define RENEWAL_DEAD_PACKET
#define ENABLE_NEW_GYEONGGONG_SKILL
#define ENABLE_NEW_PASSIVE_SKILLS
#define ENABLE_NEW_ECLIPSE_ELIXER
#if defined(ENABLE_NEW_ECLIPSE_ELIXER)
	#define ECLIPSE_ELIXER_VNUM	40002
#endif
#define CEF_BROWSER // CEF Browser
#define FIX_STEALTH_AUTO_ATTACK
#define ENABLE_DRAGON_SOUL_RENEW
#define ENABLE_CUBE_RENEWAL
#define ENABLE_MAINTENANCE_SYSTEM
#define ENABLE_NEW_EXCHANGE_WINDOW
#define ENABLE_PLAYER_PER_ACCOUNT5 // Enable 5 players per account
#define ENABLE_EXTENDED_SELL
#define TRADE_BONUS_COSTUME
#define __ENABLE_SHAMAN_ATTACK_FIX__
#define ENABLE_ANTI_MULTIPLE_FARM
#define __ENABLE_VALENTINE_EVENT__
/// /// /// /// /// /// /// /// /// ///

/// ###Dungeons
#define ENABLE_GUILD_DRAGONLAIR_SYSTEM // Guild dragon lair dungeon
#ifdef ENABLE_GUILD_DRAGONLAIR_SYSTEM
	#define ENABLE_GUILD_DRAGONLAIR_PARTY_SYSTEM
	#define GUILD_DRAGONLAIR_STONE 6118 // Guild dragon lair statue vnum
#endif
/// /// /// /// /// /// /// /// /// ///

/// ###New currency
#define ENABLE_BLUE_AND_REG_GAYA //Enable blue and red gaya
/// /// /// /// /// /// /// /// /// ///


/// ###Others - API
#define ENABLE_DISCORD_RPC

 

 

  • Funky Emulation 15
  • J'adore 28
  • J'aime 8
  • Oooh 2
Link to comment

969 0 S 0:00.37 ./auth (game)
971 0 S 0:00.91 ./game_ch1_core1 (game)
973 0 S 0:00.79 ./game_ch1_core2 (game)
975 0 S 0:00.78 ./game_ch1_core3 (game)
977 0 S 0:00.77 ./game_ch99 (game)
979 0 R+ 0:00.01 ps
[email protected]:/usr/Server # connect: Connection refused
connect: Connection refused


DB side have some problems, doesn't start. so ? some solutions ?? Thx

Link to comment

spacer.png

 

Pour ceux qui n'y arrive pas, je vais vous expliquer comment j'ai fait (en local):

(Ma méthode n'est surement pas la meilleur, mais elle à fonctionner, avec quelques bug (en compilant) que vous pourrais peux être aider à lever.)

 

--------------------------------------

1.    Assurez vous d'avoir tout ces fichier 

Révélation

---VDI FreeBSD 12.1 (Freebsd_12_1_Enix_Yazilim.rar):    LIEN

---Serverfile full (Overfall2Fixed (1).rar): LIEN

---Game + mysql (burakkk.tar.gz):             LIEN
(elle sont déjà dans l'archive "Serverfile full" mais je suis passer par ce lien pour game+mysql

La Base..
---VirtualBox : https://www.virtualbox.org/

---Visual studio 2019 Community : https://visualstudio.microsoft.com/fr/downloads/
(en installant ajouter "Développement Desktop en C++" )

---WinSCP

--------------------------------------

 

2.    Extraire : "Freebsd_12_1_Enix_Yazilim.rar" & "Overfall2Fixed (1).rar"

 

3.    Lancer VirtualBox : Outils > Nouvelle >BSD > Allouer votre RAM > disque dur virtuel existant, rechercher après "Server01.vdi"

 

4.    Paramètres > Réseau > Mode d'accès réseau : accès par pont > Choisissez votre carte > OK

 

5.    Lancer votre machine virtuel :        ID : root        PASSWD : dev

 

-On va créer nos log mysql :

 

Révélation

mysql -u root -p

ENTER            //(AUCUN MOT DE PASSE DE BASE)

 

GRANT ALL PRIVILEGES ON *.* TO 'mt2'@'localhost' IDENTIFIED BY '[email protected]#';            //Il étais de base dans "user" de Overfall, donc je les remis

 

GRANT ALL PRIVILEGES ON *.* TO 'VOTRE_ID'@'%' IDENTIFIED BY 'VOTRE_PASSWORD';        //Votre ID et Mot de passe

 

flush privileges;

 

quit

 

ifconfig

(normalement 192.168.1.100, si oui continuer, sinon je vous invite a configurer votre ip avec "bsdconfig" pour voir si tout est bien comme chez vous.

 

6.   On se connecte au FTP (pour ma part WinSCP)

Révélation

ip : 192.168.1.100  (votre IP récupéré avec ifconfig)

id : root 

pass : dev

 

6.a.    Ajouter : burakkk.tar.gz dans /usr/            //(Je le place ici pour pas écraser le mysql complétement)

sur votre machine virtuel : 

cd /usr/ 

tar zxvf burakkk.tar.gz

 

il va vous créer dans /usr/ les dossier "usr" & "var"

rentrer dans /usr/usr/ et remetter le dossier "Server" en arrière, c'est a dire dans /usr/

maintenant aller dans /usr/var/db/mysql/ puis "copier" account+common+hotbackup+log+player+test+tested

puis coller dans /var/db/mysql/

 

maintenant nous allons modifier les BIND_IP dans les CONFIG de :

Révélation

/usr/Server/auth/CONFIG

/usr/Server/game/channel1/core1/CONFIG

/usr/Server/game/channel1/core2/CONFIG

/usr/Server/game/channel1/core3/CONFIG

/usr/Server/game/channel99/core1/CONFIG

 

modifier le BIND_IP en BIND_IP: 192.168.1.100        /(ou votre ip avec ifconfig)

 

reboot

 

vous pouvez a présent lancer votre serveur avec :

Révélation

cd /usr/Server/

sh start.sh

1

 

//SI ERROR 2002 ALORS 

Révélation

ERROR 2002 (HY000): Can't connect To local MySQL serveur through socket "/tmp/mysql.Sock' (2)

 

Une erreur qui survient chez beaucoup de personnes qui installe le MySQL sur leurs machines.

 

Solution :

 

pwd_mkdb -p /etc/master.passwd

chown -R mysql /var/db/mysql && chgrp -R mysql /var/db/mysql

 

reboot

 

 

Chercher serverinfo.py dans :    Overfall2Fixed (1)\Overfall2Fixed\Overfall2 - Project\client_related\binary_source\binary_source\binary\__cython\root_modules

mettez votre adresse ip (ifconfig)

 

Chercher _make_uiscript.bat :     Overfall2Fixed (1)\Overfall2Fixed\Overfall2 - Project\client_related\binary_source\source\CUiScriptLib\Workplace

modifier les chemin vers les votres

 

Chercher _make_root.bat dans :    Overfall2Fixed (1)\Overfall2Fixed\Overfall2 - Project\client_related\binary_source\binary_source\source\CRootLib\Workplace

modifier les chemin vers les votres

 

Chercher client.sln dans :         Overfall2Fixed (1)\Overfall2Fixed\Overfall2 - Project\client_related\binary_source\binary_source

Ouvrir avec visual studio 2019

 

Clique droit sur CRootLib > Regénérer la Solution

vous pouvez le laisser sur place,il ces placer dans : Overfall2Fixed (1)\Overfall2Fixed\Overfall2 - Project\client_related\binary_source\extern\library\rootlib.lib

 

(pour ma part il se compile avec quelques erreur mais sa fonctionne quand même, voici mes erreurs pour CRootLib :

 

L'opération de régénération a démarré...

Révélation

1>------ Début de la régénération globale : Projet : CRootLib, Configuration : Release Win32 ------

1> Exécute le cythoniseur !

1>D:\binary_source\binary\__cython\root_modules\blend_table.py

1>D:\binary_source\binary\__cython\root_modules\colorinfo.py

1>D:\binary_source\binary\__cython\root_modules\consolemodule.py

1>D:\binary_source\binary\__cython\root_modules\constfunctions.py

1>D:\binary_source\binary\__cython\root_modules\constinfo.py

1>D:\binary_source\binary\__cython\root_modules\constinfo2.py

1>D:\binary_source\binary\__cython\root_modules\debuginfo.py

1>D:\binary_source\binary\__cython\root_modules\dragon_soul_refine_settings.py

1>D:\binary_source\binary\__cython\root_modules\emotion.py

1>D:\binary_source\binary\__cython\root_modules\exception.py

1>D:\binary_source\binary\__cython\root_modules\extended_sell.py

1>D:\binary_source\binary\__cython\root_modules\game.py

1>D:\binary_source\binary\__cython\root_modules\import_manager.py

1>D:\binary_source\binary\__cython\root_modules\interfacemodule.py

1>D:\binary_source\binary\__cython\root_modules\introcreate.py

1>D:\binary_source\binary\__cython\root_modules\introempire.py

1>D:\binary_source\binary\__cython\root_modules\introloading.py

1>D:\binary_source\binary\__cython\root_modules\intrologin.py

1>D:\binary_source\binary\__cython\root_modules\intrologo.py

1>D:\binary_source\binary\__cython\root_modules\introoverfallnetwork.py

1>D:\binary_source\binary\__cython\root_modules\introselect.py

1>D:\binary_source\binary\__cython\root_modules\item_names_searchshop.py

1>D:\binary_source\binary\__cython\root_modules\localeinfo.py

1>D:\binary_source\binary\__cython\root_modules\mousemodule.py

1>D:\binary_source\binary\__cython\root_modules\musicinfo.py

1>D:\binary_source\binary\__cython\root_modules\networkmodule.py

1>D:\binary_source\binary\__cython\root_modules\new_introcreate.py

1>D:\binary_source\binary\__cython\root_modules\new_introselect.py

1>D:\binary_source\binary\__cython\root_modules\playersettingmodule.py

1>D:\binary_source\binary\__cython\root_modules\prototype.py

1>D:\binary_source\binary\__cython\root_modules\searchprivateshop_cfg.py

1>D:\binary_source\binary\__cython\root_modules\servercommandparser.py

1>D:\binary_source\binary\__cython\root_modules\serverinfo.py

1>D:\binary_source\binary\__cython\root_modules\stringcommander.py

1>D:\binary_source\binary\__cython\root_modules\system.py

1>D:\binary_source\binary\__cython\root_modules\test_affect.py

1>D:\binary_source\binary\__cython\root_modules\ui.py

1>D:\binary_source\binary\__cython\root_modules\uiacce.py

1>D:\binary_source\binary\__cython\root_modules\uiaffectshower.py

1>D:\binary_source\binary\__cython\root_modules\uiantimultiplefarm.py

1>D:\binary_source\binary\__cython\root_modules\uiattachmetin.py

1>D:\binary_source\binary\__cython\root_modules\uiauction.py

1>D:\binary_source\binary\__cython\root_modules\uiautoban.py

1>D:\binary_source\binary\__cython\root_modules\uibufferinfo.py

1>D:\binary_source\binary\__cython\root_modules\uicandidate.py

1>D:\binary_source\binary\__cython\root_modules\uicaptcha.py

1>D:\binary_source\binary\__cython\root_modules\uichangelook.py

1>D:\binary_source\binary\__cython\root_modules\uicharacter.py

1>D:\binary_source\binary\__cython\root_modules\uicharacterdetails.py

1>D:\binary_source\binary\__cython\root_modules\uichat.py

1>D:\binary_source\binary\__cython\root_modules\uicommon.py

1>D:\binary_source\binary\__cython\root_modules\uicube.py

1>D:\binary_source\binary\__cython\root_modules\uicuberenewal.py

1>D:\binary_source\binary\__cython\root_modules\uidragonlairranking.py

1>D:\binary_source\binary\__cython\root_modules\uidragonsoul.py

1>D:\binary_source\binary\__cython\root_modules\uidungeoninfo.py

1>D:\binary_source\binary\__cython\root_modules\uiequipmentdialog.py

1>D:\binary_source\binary\__cython\root_modules\uiex.py

1>D:\binary_source\binary\__cython\root_modules\uiexchange.py

1>D:\binary_source\binary\__cython\root_modules\uigamebutton.py

1>D:\binary_source\binary\__cython\root_modules\uigameoption.py

1>D:\binary_source\binary\__cython\root_modules\uigayanew.py

1>D:\binary_source\binary\__cython\root_modules\uigemshop.py

1>D:\binary_source\binary\__cython\root_modules\uigiveitem.py

1>D:\binary_source\binary\__cython\root_modules\uiguild.py

1>D:\binary_source\binary\__cython\root_modules\uiguildragonlairranking.py

1>D:\binary_source\binary\__cython\root_modules\uihelp.py

1>D:\binary_source\binary\__cython\root_modules\uihelp_new.py

1>D:\binary_source\binary\__cython\root_modules\uiinventory.py

1>D:\binary_source\binary\__cython\root_modules\uimailbox.py

1>D:\binary_source\binary\__cython\root_modules\uimaintenance.py

1>D:\binary_source\binary\__cython\root_modules\uimapnameshower.py

1>D:\binary_source\binary\__cython\root_modules\uimessenger.py

1>D:\binary_source\binary\__cython\root_modules\uiminigame.py

1>D:\binary_source\binary\__cython\root_modules\uiminigamecatchking.py

1>D:\binary_source\binary\__cython\root_modules\uiminigamerumi.py

1>D:\binary_source\binary\__cython\root_modules\uiminimap.py

1>D:\binary_source\binary\__cython\root_modules\uinewoptions.py

1>D:\binary_source\binary\__cython\root_modules\uinewprivateshopsearch.py

1>D:\binary_source\binary\__cython\root_modules\uiofflineshop.py

1>D:\binary_source\binary\__cython\root_modules\uiofflineshopbuilder.py

1>D:\binary_source\binary\__cython\root_modules\uiopengiftbox.py

1>D:\binary_source\binary\__cython\root_modules\uioption.py

1>D:\binary_source\binary\__cython\root_modules\uiparty.py

1>D:\binary_source\binary\__cython\root_modules\uipartychallenge.py

1>D:\binary_source\binary\__cython\root_modules\uipetinfo.py

1>D:\binary_source\binary\__cython\root_modules\uiphasecurtain.py

1>D:\binary_source\binary\__cython\root_modules\uipicketc.py

1>D:\binary_source\binary\__cython\root_modules\uipickmoney.py

1>D:\binary_source\binary\__cython\root_modules\uiplayergauge.py

1>D:\binary_source\binary\__cython\root_modules\uipointreset.py

1>D:\binary_source\binary\__cython\root_modules\uiprivateshopbuilder.py

1>D:\binary_source\binary\__cython\root_modules\uiprivateshopsearch.py

1>D:\binary_source\binary\__cython\root_modules\uiquest.py

1>D:\binary_source\binary\__cython\root_modules\uiquestcategory.py

1>D:\binary_source\binary\__cython\root_modules\uirefine.py

1>D:\binary_source\binary\__cython\root_modules\uirestart.py

1>D:\binary_source\binary\__cython\root_modules\uisafebox.py

1>D:\binary_source\binary\__cython\root_modules\uiscriptlocale.py

1>D:\binary_source\binary\__cython\root_modules\uiselectitem.py

1>D:\binary_source\binary\__cython\root_modules\uiselectitemex.py

1>D:\binary_source\binary\__cython\root_modules\uiselectmusic.py

1>D:\binary_source\binary\__cython\root_modules\uishop.py

1>D:\binary_source\binary\__cython\root_modules\uiskillcolor.py

1>D:\binary_source\binary\__cython\root_modules\uispecialinventory.py

1>D:\binary_source\binary\__cython\root_modules\uiswitchbot.py

1>D:\binary_source\binary\__cython\root_modules\uisystem.py

1>D:\binary_source\binary\__cython\root_modules\uisystemoption.py

1>D:\binary_source\binary\__cython\root_modules\uitarget.py

1>D:\binary_source\binary\__cython\root_modules\uitaskbar.py

1>D:\binary_source\binary\__cython\root_modules\uitip.py

1>D:\binary_source\binary\__cython\root_modules\uitooltip.py

1>D:\binary_source\binary\__cython\root_modules\uitradebonuscostume.py

1>D:\binary_source\binary\__cython\root_modules\uiuploadmark.py

1>D:\binary_source\binary\__cython\root_modules\uiweb.py

1>D:\binary_source\binary\__cython\root_modules\uiwhisper.py

1> 116 fichier(s) copié(s).

1> copie terminée

1> PythonrootlibManager créé avec succès.

1>Appuyez sur une touche pour continuer...

1>blend_table.c

1>colorInfo.c

1>ConsoleModule.c

1>constfunctions.c

1>constInfo.c

1>constinfo2.c

1> debugInfo.c

1>dragon_soul_refine_settings.c

1> émotion.c

1>exception.c

1>vente_étendue.c

1>jeu.c

1> gestionnaire_import.c

1> interfaceModule.c

1>introCréer.c

1>introEmpire.c

1>introChargement.c

1>introLogin.c

1> introLogo.c

1>introoverfallnetwork.c

1>introSelect.c

1>item_names_searchshop.c

1>localInfo.c

1> module.c

1>musicInfo.c

1> module de réseau.c

1>nouveau_introcreate.c

1>nouveau_introselect.c

1>playerSettingModule.c

1>Prototype.c

1>searchprivateshop_cfg.c

1>serverCommandParser.c

1>serverInfo.c

1>stringCommander.c

1> système.c

1> test_affect.c

1>ui.c

1>uiacce.c

1>uiAffectDouche.c

1>uiantimultiplefarm.c

1>uiAttachMetin.c

1> uiAuction.c

1>uiAutoban.c

1>uibufferinfo.c

1>uiCandidate.c

1>uicaptcha.c

1> uichangelook.c

1>uiCharacter.c

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiCharacter.c(63337.45): warning C4146: opérateur moins unaire appliqué à un type non signé, le résultat sera non signé

1>uicharacterdetails.c

1>uiChat.c

1>uiCommon.c

1>uiCube.c

1>uicubernewal.c

1>uidragonlairranking.c

1> uiDragonSoul.c

1>uidungeoninfo.c

1>uiEquipmentDialog.c

1>uiEx.c

1>uiExchange.c

1> uiGameButton.c

1>uiGameOption.c

1>uigayanew.c

1>uigemshop.c

1>uigiveitem.c

1>uiGuilde.c

1>uiguilddragonlairranking.c

1> uiHelp.c

1>uihelp_new.c

1>uiInventaire.c

1>uimailbox.c

1>uimaintenance.c

1>uiMapNameShower.c

1>uiMessenger.c

1> uiminigame.c

1>uiminigamecatchking.c

1>uiminigamerumi.c

1>uiMiniMap.c

1> uinewoptions.c

1>uinewprivateshopsearch.c

1>uiofflineshop.c

1>uiofflineshopbuilder.c

1>uiopengiftbox.c

1>uiOption.c

1> uiPartie.c

1>uipartychallenge.c

1>uipetinfo.c

1> uiPhaseCurtain.c

1>uipicketc.c

1>uiPickMoney.c

1>uiPlayerGauge.c

1>uiPointReset.c

1>uiPrivateShopBuilder.c

1>uiprivateshopsearch.c

1>uiQuest.c

1> uiquestcategory.c

1>uiAffiner.c

1>uiRestart.c

1>uiSafebox.c

1>uiScriptLocale.c

1>uiselectitem.c

1>uiselectitemex.c

1>uiSelectMusic.c

1>uiShop.c

1>uiskillcolor.c

1>uispecialinventory.c

1>uiswitchbot.c

1>uiSystem.c

1>uiSystemOption.c

1>uiTarget.c

1>uiTaskBar.c

1>uiTip.c

1>uiToolTip.c

1>uitradebonuscostume.c

1>uiUploadMark.c

1>uiWeb.c

1>uiWhisper.c

1>CRootLib.vcxproj -> D:\binary_source\extern\library\rootlib.lib

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\game.c(26407): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\interfaceModule.c(25269): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\item_names_searchshop.c(56685): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\localeInfo.c(31505): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\new_introcreate.c(22590): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\new_introselect.c(22464): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\ui.c(31347): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiCharacter.c(23239): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiChat.c(23678): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiCommon.c(25503): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiDragonSoul.c(22676): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiGuild.c(26090): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiInventory.c(22965): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uimailbox.c(23772): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiMessenger.c(25865) : avertissement BK4504 : le fichier contient trop de rÚfÚrencesá ; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiminigamecatchking.c(23572): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uinewoptions.c(20632): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uinewprivateshopsearch.c(23736): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiofflineshop.c(22716): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uipetinfo.c(23144): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiprivateshopsearch.c(21999): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiQuest.c(22605): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiSafebox.c(23015): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uispecialinventory.c(22227): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiswitchbot.c(22739): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiSystemOption.c(25049): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiTarget.c(22063): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiTaskBar.c(23632): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiToolTip.c(25567): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>Génération du Projet "CRootLib.vcxproj" terminée.

========== Régénération globale : 1 a réussi, 0 a échoué, 0 a été ignoré ==========

 

 

ensuite regenerer la solution complete de " Solution 'client'

 

mes erreur en compilant(mais sa fonctionne !)

 

L'opération de regénération a démarré...

Révélation

1>------ Début de la regénération globale : Projet : EterLocale, Configuration : Release Win32 ------

2>------ Début de la regénération globale : Projet : CWebBrowser, Configuration : Release Win32 ------

3>------ Début de la regénération globale : Projet : EffectLib, Configuration : Release Win32 ------

4>------ Début de la regénération globale : Projet : EterBase, Configuration : Release Win32 ------

1>StdAfx.cpp

1>Arabic.cpp

1>Japanese.cpp

1>StringCodec.cpp

1>StringCodec_Vietnamese.cpp

1>Génération de code en cours...

1>EterLocale.vcxproj -> D:\binary_source\vs_files\EterLocale\Release\EterLocale.lib

5>------ Début de la regénération globale : Projet : EterGrnLib, Configuration : Release Win32 ------

4>StdAfx.cpp

2>CWebBrowser.c

5>StdAfx.cpp

2>CWebBrowser.vcxproj -> D:\binary_source\vs_files\CWebBrowser\Release\CWebBrowser.lib

3>StdAfx.cpp

6>------ Début de la regénération globale : Projet : EterImageLib, Configuration : Release Win32 ------

5>LODController.cpp

6>StdAfx.cpp

5>Material.cpp

5>Mesh.cpp

5>Model.cpp

5>ModelInstance.cpp

5>ModelInstanceCollisionDetection.cpp

5>ModelInstanceModel.cpp

6>DXTCImage.cpp

6>Image.cpp

6>TGAImage.cpp

6>Génération de code en cours...

5>ModelInstanceMotion.cpp

5>ModelInstanceRender.cpp

6>EterImageLib.vcxproj -> D:\binary_source\vs_files\EterImageLib\Release\EterImageLib.lib

7>------ Début de la regénération globale : Projet : EterLib, Configuration : Release Win32 ------

5>ModelInstanceUpdate.cpp

5>Motion.cpp

5>Thing.cpp

5>ThingInstance.cpp

7>StdAfx.cpp

5>Util.cpp

5>Génération de code en cours...

7>AttributeData.cpp

4>cipher.cpp

4>CPostIt.cpp

4>CRC32.cpp

4>Debug.cpp

4>error.cpp

4>FileBase.cpp

4>FileDir.cpp

4>FileLoader.cpp

4>lzo.cpp

4>MappedFile.cpp

4>Base.cpp

4>Poly.cpp

4>Symbol.cpp

4>SymTable.cpp

4>Random.cpp

4>Stl.cpp

4>tea.cpp

4>TempFile.cpp

4>Timer.cpp

4>Utils.cpp

4>Génération de code en cours...

7>AttributeInstance.cpp

3>EffectData.cpp

3>EffectElementBase.cpp

3>EffectElementBaseInstance.cpp

3>EffectInstance.cpp

3>EffectManager.cpp

3>EffectMesh.cpp

3>EffectMeshInstance.cpp

3>EffectUpdateDecorator.cpp

3>EmitterProperty.cpp

3>FrameController.cpp

3>ParticleInstance.cpp

3>ParticleProperty.cpp

3>ParticleSystemData.cpp

3>ParticleSystemInstance.cpp

3>SimpleLightData.cpp

5>EterGrnLib.vcxproj -> D:\binary_source\vs_files\EterGrnLib\Release\EterGrnLib.lib

8>------ Début de la regénération globale : Projet : EterPack, Configuration : Release Win32 ------

3>SimpleLightInstance.cpp

7>BlockTexture.cpp

4>EterBase.vcxproj -> D:\binary_source\vs_files\EterBase\Release\EterBase.lib

3>Type.cpp

7>Camera.cpp

9>------ Début de la regénération globale : Projet : EterPythonLib, Configuration : Release Win32 ------

3>Génération de code en cours...

7>CollisionData.cpp

7>ColorTransitionHelper.cpp

7>CRenderTarget.cpp

7>D:\binary_source\source\eterLib\SkyBox.h(108,2): warning C5208: la classe sans nom utilisée dans le nom de typedef ne peut pas déclarer de membres qui ne sont pas des membres de données non statiques, des énumérations de membres ou des classes membres

9>StdAfx.cpp

7>CRenderTargetManager.cpp

7>CullingManager.cpp

7>Decal.cpp

7>DibBar.cpp

7>EnvironmentMap.cpp

7>FileLoaderThread.cpp

8>EterPack.cpp

8>EterPackCursor.cpp

9>PythonGraphic.cpp

9>PythonGraphicImageModule.cpp

9>PythonGraphicModule.cpp

7>GrpBase.cpp

9>PythonGraphicTextModule.cpp

3>EffectLib.vcxproj -> D:\binary_source\vs_files\EffectLib\Release\EffectLib.lib

7>GrpCollisionObject.cpp

10>------ Début de la regénération globale : Projet : GameLib, Configuration : Release Win32 ------

9>PythonGraphicThingModule.cpp

9>PythonGridSlotWindow.cpp

7>GrpColor.cpp

7>GrpColorInstance.cpp

7>GrpD3DXBuffer.cpp

9>PythonSlotWindow.cpp

7>GrpDetector.cpp

9>PythonWindow.cpp

7>GrpDevice.cpp

9>PythonWindowManager.cpp

7>Génération de code en cours...

9>PythonWindowManagerModule.cpp

9>Génération de code en cours...

7>Compilation en cours...

7>GrpDIB.cpp

7>GrpExpandedImageInstance.cpp

10>StdAfx.cpp

8>EterPackManager.cpp

10>D:\binary_source\source\eterLib\SkyBox.h(108,2): warning C5208: la classe sans nom utilisée dans le nom de typedef ne peut pas déclarer de membres qui ne sont pas des membres de données non statiques, des énumérations de membres ou des classes membres

7>GrpFontTexture.cpp

10>ActorInstance.cpp

8>EterPackPolicy_CSHybridCrypt.cpp

7>GrpImage.cpp

9>EterPythonLib.vcxproj -> D:\binary_source\vs_files\EterPythonLib\Release\EterPythonLib.lib

11>------ Début de la regénération globale : Projet : MilesLib, Configuration : Release Win32 ------

7>GrpImageInstance.cpp

7>GrpImageTexture.cpp

10>ActorInstanceAttach.cpp

7>GrpIndexBuffer.cpp

11>Stdafx.cpp

7>GrpLightManager.cpp

10>ActorInstanceBattle.cpp

7>GrpMarkInstance.cpp

8>StdAfx.cpp

7>GrpMath.cpp

7>GrpObjectInstance.cpp

7>GrpPixelShader.cpp

7>GrpRatioInstance.cpp

7>GrpRenderTargetTexture.cpp

7>GrpScreen.cpp

10>ActorInstanceBlend.cpp

7>GrpShadowTexture.cpp

7>GrpSubImage.cpp

8>Génération de code en cours...

7>GrpText.cpp

7>GrpTextInstance.cpp

10>ActorInstanceCollisionDetection.cpp

7>GrpTexture.cpp

7>Génération de code en cours...

11>SoundBase.cpp

11>SoundData.cpp

11>SoundInstance2D.cpp

11>SoundInstance3D.cpp

11>SoundInstanceStream.cpp

11>SoundManager.cpp

11>SoundManager2D.cpp

11>SoundManager3D.cpp

11>SoundManagerStream.cpp

11>Type.cpp

11>Génération de code en cours...

8>md5.c

11>MilesLib.vcxproj -> D:\binary_source\vs_files\MilesLib\Release\MilesLib.lib

12>------ Début de la regénération globale : Projet : PRTerrainLib, Configuration : Release Win32 ------

8>EterPack.vcxproj -> D:\binary_source\vs_files\EterPack\Release\EterPack.lib

12>StdAfx.cpp

7>Compilation en cours...

7>GrpVertexBuffer.cpp

7>GrpVertexBufferDynamic.cpp

7>GrpVertexBufferStatic.cpp

7>GrpVertexShader.cpp

7>IME.cpp

7>Input.cpp

7>JpegFile.cpp

7>LensFlare.cpp

7>lineintersect_utils.cpp

7>MSApplication.cpp

13>------ Début de la regénération globale : Projet : ScriptLib, Configuration : Release Win32 ------

10>ActorInstanceData.cpp

10>ActorInstanceEvent.cpp

7>MSWindow.cpp

10>ActorInstanceFly.cpp

12>Terrain.cpp

10>ActorInstanceMotion.cpp

12>TextureSet.cpp

12>Génération de code en cours...

13>StdAfx.cpp

7>Mutex.cpp

10>ActorInstanceMotionEvent.cpp

7>NetAddress.cpp

7>NetDatagram.cpp

7>NetDatagramReceiver.cpp

7>NetDatagramSender.cpp

7>NetDevice.cpp

7>NetPacketHeaderMap.cpp

7>NetStream.cpp

7>parser.cpp

7>Génération de code en cours...

7>Compilation en cours...

7>PathStack.cpp

7>ReferenceObject.cpp

7>Resource.cpp

12>TerrainLib.vcxproj -> D:\binary_source\vs_files\TerrainLib\Release\PRTerrainLib.lib

14>------ Début de la regénération globale : Projet : SpeedTreeLib, Configuration : Release Win32 ------

14>StdAfx.cpp

10>ActorInstancePosition.cpp

10>ActorInstanceRender.cpp

14>BoundaryShapeManager.cpp

14>SpeedGrassRT.cpp

14>SpeedGrassWrapper.cpp

14>SpeedTreeForest.cpp

10>ActorInstanceRotation.cpp

13>PythonDebugModule.cpp

7>ResourceManager.cpp

7>ScreenFilter.cpp

7>SkyBox.cpp

7>D:\binary_source\source\EterLib\SkyBox.h(108,2): warning C5208: la classe sans nom utilisée dans le nom de typedef ne peut pas déclarer de membres qui ne sont pas des membres de données non statiques, des énumérations de membres ou des classes membres

7>StateManager.cpp

7>TargaResource.cpp

7>TextBar.cpp

13>PythonLauncher.cpp

13>PythonMarshal.cpp

13>PythonUtils.cpp

13>Resource.cpp

13>D:\binary_source\source\eterLib\SkyBox.h(108,2): warning C5208: la classe sans nom utilisée dans le nom de typedef ne peut pas déclarer de membres qui ne sont pas des membres de données non statiques, des énumérations de membres ou des classes membres

13>Génération de code en cours...

7>TextFileLoader.cpp

13>ScriptLib.vcxproj -> D:\binary_source\vs_files\ScriptLib\Release\ScriptLib.lib

13>Génération du projet "ScriptLib.vcxproj" terminée.

15>------ Début de la regénération globale : Projet : SphereLib, Configuration : Release Win32 ------

14>SpeedTreeForestDirectX8.cpp

10>ActorInstanceSync.cpp

14>SpeedTreeWrapper.cpp

14>Génération de code en cours...

7>TextTag.cpp

10>ActorInstanceWeaponTrace.cpp

7>Thread.cpp

14>SpeedTreeLib.vcxproj -> D:\binary_source\vs_files\SpeedTreeLib\Release\SpeedTreeLib.lib

16>------ Début de la regénération globale : Projet : CRootLib, Configuration : Release Win32 ------

7>Util.cpp

16>Executes the cythonizer!

10>Area.cpp

16>D:\binary_source\binary\__cython\root_modules\blend_table.py

16>D:\binary_source\binary\__cython\root_modules\colorinfo.py

16>D:\binary_source\binary\__cython\root_modules\consolemodule.py

16>D:\binary_source\binary\__cython\root_modules\constfunctions.py

16>D:\binary_source\binary\__cython\root_modules\constinfo.py

16>D:\binary_source\binary\__cython\root_modules\constinfo2.py

16>D:\binary_source\binary\__cython\root_modules\debuginfo.py

16>D:\binary_source\binary\__cython\root_modules\dragon_soul_refine_settings.py

16>D:\binary_source\binary\__cython\root_modules\emotion.py

16>D:\binary_source\binary\__cython\root_modules\exception.py

16>D:\binary_source\binary\__cython\root_modules\extended_sell.py

15>StdAfx.cpp

16>D:\binary_source\binary\__cython\root_modules\game.py

16>D:\binary_source\binary\__cython\root_modules\import_manager.py

16>D:\binary_source\binary\__cython\root_modules\interfacemodule.py

7>Génération de code en cours...

16>D:\binary_source\binary\__cython\root_modules\introcreate.py

16>D:\binary_source\binary\__cython\root_modules\introempire.py

16>D:\binary_source\binary\__cython\root_modules\introloading.py

16>D:\binary_source\binary\__cython\root_modules\intrologin.py

16>D:\binary_source\binary\__cython\root_modules\intrologo.py

16>D:\binary_source\binary\__cython\root_modules\introoverfallnetwork.py

16>D:\binary_source\binary\__cython\root_modules\introselect.py

16>D:\binary_source\binary\__cython\root_modules\item_names_searchshop.py

16>D:\binary_source\binary\__cython\root_modules\localeinfo.py

16>D:\binary_source\binary\__cython\root_modules\mousemodule.py

16>D:\binary_source\binary\__cython\root_modules\musicinfo.py

16>D:\binary_source\binary\__cython\root_modules\networkmodule.py

16>D:\binary_source\binary\__cython\root_modules\new_introcreate.py

16>D:\binary_source\binary\__cython\root_modules\new_introselect.py

16>D:\binary_source\binary\__cython\root_modules\playersettingmodule.py

16>D:\binary_source\binary\__cython\root_modules\prototype.py

16>D:\binary_source\binary\__cython\root_modules\searchprivateshop_cfg.py

16>D:\binary_source\binary\__cython\root_modules\servercommandparser.py

16>D:\binary_source\binary\__cython\root_modules\serverinfo.py

16>D:\binary_source\binary\__cython\root_modules\stringcommander.py

16>D:\binary_source\binary\__cython\root_modules\system.py

16>D:\binary_source\binary\__cython\root_modules\test_affect.py

16>D:\binary_source\binary\__cython\root_modules\ui.py

16>D:\binary_source\binary\__cython\root_modules\uiacce.py

15>frustum.cpp

15>sphere.cpp

15>spherepack.cpp

15>Génération de code en cours...

16>D:\binary_source\binary\__cython\root_modules\uiaffectshower.py

16>D:\binary_source\binary\__cython\root_modules\uiantimultiplefarm.py

16>D:\binary_source\binary\__cython\root_modules\uiattachmetin.py

16>D:\binary_source\binary\__cython\root_modules\uiauction.py

16>D:\binary_source\binary\__cython\root_modules\uiautoban.py

16>D:\binary_source\binary\__cython\root_modules\uibufferinfo.py

16>D:\binary_source\binary\__cython\root_modules\uicandidate.py

16>D:\binary_source\binary\__cython\root_modules\uicaptcha.py

16>D:\binary_source\binary\__cython\root_modules\uichangelook.py

16>D:\binary_source\binary\__cython\root_modules\uicharacter.py

16>D:\binary_source\binary\__cython\root_modules\uicharacterdetails.py

16>D:\binary_source\binary\__cython\root_modules\uichat.py

16>D:\binary_source\binary\__cython\root_modules\uicommon.py

16>D:\binary_source\binary\__cython\root_modules\uicube.py

16>D:\binary_source\binary\__cython\root_modules\uicuberenewal.py

16>D:\binary_source\binary\__cython\root_modules\uidragonlairranking.py

16>D:\binary_source\binary\__cython\root_modules\uidragonsoul.py

16>D:\binary_source\binary\__cython\root_modules\uidungeoninfo.py

16>D:\binary_source\binary\__cython\root_modules\uiequipmentdialog.py

16>D:\binary_source\binary\__cython\root_modules\uiex.py

16>D:\binary_source\binary\__cython\root_modules\uiexchange.py

16>D:\binary_source\binary\__cython\root_modules\uigamebutton.py

15>SphereLib.vcxproj -> D:\binary_source\vs_files\SphereLib\Release\SphereLib.lib

17>------ Début de la regénération globale : Projet : CUiScriptLib, Configuration : Release Win32 ------

16>D:\binary_source\binary\__cython\root_modules\uigameoption.py

16>D:\binary_source\binary\__cython\root_modules\uigayanew.py

16>D:\binary_source\binary\__cython\root_modules\uigemshop.py

16>D:\binary_source\binary\__cython\root_modules\uigiveitem.py

16>D:\binary_source\binary\__cython\root_modules\uiguild.py

16>D:\binary_source\binary\__cython\root_modules\uiguilddragonlairranking.py

16>D:\binary_source\binary\__cython\root_modules\uihelp.py

16>D:\binary_source\binary\__cython\root_modules\uihelp_new.py

16>D:\binary_source\binary\__cython\root_modules\uiinventory.py

16>D:\binary_source\binary\__cython\root_modules\uimailbox.py

16>D:\binary_source\binary\__cython\root_modules\uimaintenance.py

16>D:\binary_source\binary\__cython\root_modules\uimapnameshower.py

16>D:\binary_source\binary\__cython\root_modules\uimessenger.py

16>D:\binary_source\binary\__cython\root_modules\uiminigame.py

16>D:\binary_source\binary\__cython\root_modules\uiminigamecatchking.py

16>D:\binary_source\binary\__cython\root_modules\uiminigamerumi.py

16>D:\binary_source\binary\__cython\root_modules\uiminimap.py

16>D:\binary_source\binary\__cython\root_modules\uinewoptions.py

16>D:\binary_source\binary\__cython\root_modules\uinewprivateshopsearch.py

16>D:\binary_source\binary\__cython\root_modules\uiofflineshop.py

16>D:\binary_source\binary\__cython\root_modules\uiofflineshopbuilder.py

16>D:\binary_source\binary\__cython\root_modules\uiopengiftbox.py

16>D:\binary_source\binary\__cython\root_modules\uioption.py

16>D:\binary_source\binary\__cython\root_modules\uiparty.py

16>D:\binary_source\binary\__cython\root_modules\uipartychallenge.py

16>D:\binary_source\binary\__cython\root_modules\uipetinfo.py

17>Executes the cythonizer!

16>D:\binary_source\binary\__cython\root_modules\uiphasecurtain.py

16>D:\binary_source\binary\__cython\root_modules\uipicketc.py

17>D:\binary_source\binary\__cython\uiscript_modules\acceptguildwardialog.py

16>D:\binary_source\binary\__cython\root_modules\uipickmoney.py

16>D:\binary_source\binary\__cython\root_modules\uiplayergauge.py

16>D:\binary_source\binary\__cython\root_modules\uipointreset.py

16>D:\binary_source\binary\__cython\root_modules\uiprivateshopbuilder.py

16>D:\binary_source\binary\__cython\root_modules\uiprivateshopsearch.py

17>D:\binary_source\binary\__cython\uiscript_modules\acce_absorbwindow.py

16>D:\binary_source\binary\__cython\root_modules\uiquest.py

17>D:\binary_source\binary\__cython\uiscript_modules\acce_combinewindow.py

16>D:\binary_source\binary\__cython\root_modules\uiquestcategory.py

16>D:\binary_source\binary\__cython\root_modules\uirefine.py

17>D:\binary_source\binary\__cython\uiscript_modules\antimultiplefarmwindow.py

16>D:\binary_source\binary\__cython\root_modules\uirestart.py

16>D:\binary_source\binary\__cython\root_modules\uisafebox.py

16>D:\binary_source\binary\__cython\root_modules\uiscriptlocale.py

16>D:\binary_source\binary\__cython\root_modules\uiselectitem.py

16>D:\binary_source\binary\__cython\root_modules\uiselectitemex.py

16>D:\binary_source\binary\__cython\root_modules\uiselectmusic.py

16>D:\binary_source\binary\__cython\root_modules\uishop.py

17>D:\binary_source\binary\__cython\uiscript_modules\atlaswindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\attachstonedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\auctionwindow.py

16>D:\binary_source\binary\__cython\root_modules\uiskillcolor.py

17>D:\binary_source\binary\__cython\uiscript_modules\auctionwindow_listpage.py

16>D:\binary_source\binary\__cython\root_modules\uispecialinventory.py

16>D:\binary_source\binary\__cython\root_modules\uiswitchbot.py

17>D:\binary_source\binary\__cython\uiscript_modules\auctionwindow_registerpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\auctionwindow_uniqueauctionpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\autowindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\battlefieldwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\bead.py

17>D:\binary_source\binary\__cython\uiscript_modules\beltinventorywindow.py

16>D:\binary_source\binary\__cython\root_modules\uisystem.py

16>D:\binary_source\binary\__cython\root_modules\uisystemoption.py

17>D:\binary_source\binary\__cython\uiscript_modules\bufferinfowindow.py

16>D:\binary_source\binary\__cython\root_modules\uitarget.py

16>D:\binary_source\binary\__cython\root_modules\uitaskbar.py

17>D:\binary_source\binary\__cython\uiscript_modules\buildguildbuildingchangewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\buildguildbuildingwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\captchadialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\changegradenamedialog.py

16>D:\binary_source\binary\__cython\root_modules\uitip.py

16>D:\binary_source\binary\__cython\root_modules\uitooltip.py

16>D:\binary_source\binary\__cython\root_modules\uitradebonuscostume.py

17>D:\binary_source\binary\__cython\uiscript_modules\changelookwindow.py

16>D:\binary_source\binary\__cython\root_modules\uiuploadmark.py

16>D:\binary_source\binary\__cython\root_modules\uiweb.py

16>D:\binary_source\binary\__cython\root_modules\uiwhisper.py

17>D:\binary_source\binary\__cython\uiscript_modules\changepassworddialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\characterdetailswindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\characterwindow.py

16>      116 fichier(s) copié(s).

16>copy completed

17>D:\binary_source\binary\__cython\uiscript_modules\characterwindowbonusstruct.py

17>D:\binary_source\binary\__cython\uiscript_modules\connectingdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\costumewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\createcharacterwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\cuberenewalwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\cuberesultwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\cubewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\declareguildwardialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\declareguildwarselectdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\dragonsoulattr.py

17>D:\binary_source\binary\__cython\uiscript_modules\dragonsoulrefinewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\dragonsoulwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\dungeoninfowindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\dungeonrankingwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\energybar.py

17>D:\binary_source\binary\__cython\uiscript_modules\equipmentdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\exchangedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\exchangedialog_new.py

17>D:\binary_source\binary\__cython\uiscript_modules\expandedmoneytaskbar.py

17>D:\binary_source\binary\__cython\uiscript_modules\expandedtaskbar.py

17>D:\binary_source\binary\__cython\uiscript_modules\fishingwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\gameoptiondialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\gameoptiondialog_formobile.py

17>D:\binary_source\binary\__cython\uiscript_modules\gamewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\gayarenewal.py

17>D:\binary_source\binary\__cython\uiscript_modules\gemshopwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\giftbox.py

17>D:\binary_source\binary\__cython\uiscript_modules\guilddonatedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildlanddealdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildlanddealvotedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildpopupdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildresultpopupdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildvotepopupdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildvotepopupdialog2.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_baseinfopage.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_bcp.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_boardpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_gradepage.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildbank.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildbanklog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guilddragonlairranking.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildinfopage.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildinfopage_eu.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildinfopage_jp.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildlistwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildrankingwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildskillpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_memberpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_warscoreboard.py

17>D:\binary_source\binary\__cython\uiscript_modules\helpwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\helpwindow2.py

17>D:\binary_source\binary\__cython\uiscript_modules\helpwindownew.py

17>D:\binary_source\binary\__cython\uiscript_modules\imekor.py

17>D:\binary_source\binary\__cython\uiscript_modules\inputdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\inputdialogofflineshop.py

17>D:\binary_source\binary\__cython\uiscript_modules\inputdialogshop.py

17>D:\binary_source\binary\__cython\uiscript_modules\inputdialogwithdescription.py

17>D:\binary_source\binary\__cython\uiscript_modules\inputdialogwithdescription2.py

17>D:\binary_source\binary\__cython\uiscript_modules\inventorywindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\itemcombinationwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\keychange_window.py

17>D:\binary_source\binary\__cython\uiscript_modules\loadingwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\loginwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\mailbox.py

17>D:\binary_source\binary\__cython\uiscript_modules\mailboxlist.py

17>D:\binary_source\binary\__cython\uiscript_modules\maintenancewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\mallwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\marklistwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\messengerwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigameattendance.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamecatchkinggamepage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamecatchkingsimplewaitingpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamecatchkingwaitingpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamefisheventwaitingpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamefishgamepage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamerumigamepage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamerumiwaitingpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigameyutnorigamepage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigameyutnoriwaitingpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minimap.py

16>PythonrootlibManager successfully created.

16>Appuyez sur une touche pour continuer...

17>D:\binary_source\binary\__cython\uiscript_modules\moneyinputdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\moneyinputdialognew.py

17>D:\binary_source\binary\__cython\uiscript_modules\monstercardwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\mousebuttonwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\movechanneldialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\musiclistwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\myshopdecorationwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\newprivateshopsearch.py

17>D:\binary_source\binary\__cython\uiscript_modules\newprivateshopsearchfilter.py

17>D:\binary_source\binary\__cython\uiscript_modules\newtaskbar.py

17>D:\binary_source\binary\__cython\uiscript_modules\new_createcharacterwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\new_inventorywindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\new_selectcharacterwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshopadminpanel.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshopbuilder.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshopcreatedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshopdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshopmanagerdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshopsaleswindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshop_banka.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshop_bankdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\opengiftboxui.py

17>D:\binary_source\binary\__cython\uiscript_modules\openofflineshopdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\overfallnetworkcheck.py

17>D:\binary_source\binary\__cython\uiscript_modules\partymatchwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\partymemberinfoboard.py

17>D:\binary_source\binary\__cython\uiscript_modules\passworddialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\pethatchingwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\petinformationwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\petminiinformationwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\petnamechangewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\picketcdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\pickmoneydialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\pickoffshopmoneydialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\popupdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\popupdialog2.py

17>D:\binary_source\binary\__cython\uiscript_modules\postread.py

17>D:\binary_source\binary\__cython\uiscript_modules\postwrite.py

17>D:\binary_source\binary\__cython\uiscript_modules\privateshopbuilder.py

17>D:\binary_source\binary\__cython\uiscript_modules\privateshopdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\privateshopsearchdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\questdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\questiondialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\questiondialog2.py

17>D:\binary_source\binary\__cython\uiscript_modules\questiondialog_confirmdestroy.py

17>D:\binary_source\binary\__cython\uiscript_modules\questiondropdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\questiondropdialogitem.py

17>D:\binary_source\binary\__cython\uiscript_modules\questiondueloptiondialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\rankingboardwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\refinedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\registerchallengewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\restartdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\rightmousebuttonwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\safeboxwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\safeboxwindow_spcinv.py

17>D:\binary_source\binary\__cython\uiscript_modules\selectattrdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\selectcharacterwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\selectempirewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\selectitemwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\shopdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\shopdialog_.py

17>D:\binary_source\binary\__cython\uiscript_modules\skillbookcombinationdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\skillcolorwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\skillpointresetdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\specialgachawindow.py

10>AreaLoaderThread.cpp

17>D:\binary_source\binary\__cython\uiscript_modules\specialinventorywindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\systemdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\systemdialog_formall.py

17>D:\binary_source\binary\__cython\uiscript_modules\systemdialog_forportal.py

17>D:\binary_source\binary\__cython\uiscript_modules\systemoptiondialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\taskbar.py

17>D:\binary_source\binary\__cython\uiscript_modules\tradebonuscostume.py

17>D:\binary_source\binary\__cython\uiscript_modules\usersituationnotice.py

17>D:\binary_source\binary\__cython\uiscript_modules\weblinkedbannerwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\webwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\whisperdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\wndgiveitem.py

17>      183 fichier(s) copié(s).

17>copy completed

10>AreaTerrain.cpp

16>blend_table.c

16>colorInfo.c

16>consoleModule.c

16>constfunctions.c

16>constInfo.c

16>constinfo2.c

16>debugInfo.c

16>dragon_soul_refine_settings.c

16>emotion.c

16>exception.c

16>extended_sell.c

16>game.c

16>import_manager.c

16>interfaceModule.c

10>DragonSoulTable.cpp

16>introCreate.c

10>DungeonBlock.cpp

10>Génération de code en cours...

17>PythonuiscriptlibManager successfully created.

16>introEmpire.c

17>Appuyez sur une touche pour continuer...

16>introLoading.c

16>introLogin.c

16>introLogo.c

16>introoverfallnetwork.c

16>introSelect.c

17>Prototype.c

10>Compilation en cours...

10>FlyingData.cpp

10>FlyingInstance.cpp

16>item_names_searchshop.c

16>localeInfo.c

16>mouseModule.c

10>FlyingObjectManager.cpp

17>system.c

17>acceptguildwardialog.c

17>acce_absorbwindow.c

17>acce_combinewindow.c

17>antimultiplefarmwindow.c

17>atlaswindow.c

17>attachstonedialog.c

17>auctionwindow.c

17>auctionwindow_listpage.c

17>auctionwindow_registerpage.c

17>auctionwindow_uniqueauctionpage.c

17>autowindow.c

17>battlefieldwindow.c

17>bead.c

17>beltinventorywindow.c

17>bufferinfowindow.c

17>buildguildbuildingchangewindow.c

17>buildguildbuildingwindow.c

17>captchadialog.c

17>changegradenamedialog.c

10>FlyTarget.cpp

17>changelookwindow.c

7>EterLib.vcxproj -> D:\binary_source\vs_files\EterLib\Release\EterLib.lib

10>FlyTrace.cpp

10>GameEventManager.cpp

16>musicInfo.c

16>networkModule.c

10>GameType.cpp

16>new_introcreate.c

10>GameUtil.cpp

10>ItemData.cpp

10>ItemManager.cpp

10>MapBase.cpp

10>MapManager.cpp

10>MapOutdoor.cpp

16>new_introselect.c

10>MapOutdoorCharacterShadow.cpp

10>MapOutdoorIndexBuffer.cpp

10>MapOutdoorLoad.cpp

7>Génération du projet "EterLib.vcxproj" terminée.

17>changepassworddialog.c

17>characterdetailswindow.c

17>characterwindow.c

17>characterwindowbonusstruct.c

17>connectingdialog.c

17>costumewindow.c

17>createcharacterwindow.c

17>cuberenewalwindow.c

17>cuberesultwindow.c

17>cubewindow.c

17>declareguildwardialog.c

16>playerSettingModule.c

17>declareguildwarselectdialog.c

17>dragonsoulattr.c

17>dragonsoulrefinewindow.c

17>dragonsoulwindow.c

17>dungeoninfowindow.c

16>Prototype.c

17>dungeonrankingwindow.c

17>energybar.c

17>equipmentdialog.c

17>exchangedialog.c

17>exchangedialog_new.c

17>expandedmoneytaskbar.c

17>expandedtaskbar.c

17>fishingwindow.c

17>gameoptiondialog.c

17>gameoptiondialog_formobile.c

10>MapOutdoorQuadtree.cpp

16>searchprivateshop_cfg.c

17>gamewindow.c

10>MapOutdoorRender.cpp

17>gayarenewal.c

16>serverCommandParser.c

17>gemshopwindow.c

16>serverInfo.c

10>MapOutdoorRenderHTP.cpp

17>giftbox.c

17>guilddonatedialog.c

16>stringCommander.c

10>MapOutdoorRenderSTP.cpp

16>system.c

16>test_affect.c

10>Génération de code en cours...

16>ui.c

16>uiacce.c

17>guildlanddealdialog.c

17>guildlanddealvotedialog.c

17>guildpopupdialog.c

16>uiAffectShower.c

17>guildresultpopupdialog.c

16>uiantimultiplefarm.c

17>guildvotepopupdialog.c

17>guildvotepopupdialog2.c

17>guildwindow.c

17>guildwindow_baseinfopage.c

17>guildwindow_bcp.c

17>guildwindow_boardpage.c

17>guildwindow_gradepage.c

16>uiAttachMetin.c

17>guildwindow_guildbank.c

17>guildwindow_guildbanklog.c

17>guildwindow_guilddragonlairranking.c

16>uiAuction.c

17>guildwindow_guildinfopage.c

16>uiAutoban.c

17>guildwindow_guildinfopage_eu.c

17>guildwindow_guildinfopage_jp.c

10>Compilation en cours...

10>MapOutdoorUpdate.cpp

16>uibufferinfo.c

17>guildwindow_guildlistwindow.c

16>uiCandidate.c

10>MapOutdoorWater.cpp

16>uicaptcha.c

17>guildwindow_guildrankingwindow.c

10>MapType.cpp

10>MapUtil.cpp

17>guildwindow_guildskillpage.c

10>MonsterAreaInfo.cpp

10>PhysicsObject.cpp

10>Property.cpp

16>uichangelook.c

17>guildwindow_memberpage.c

17>guildwindow_warscoreboard.c

17>helpwindow.c

16>uiCharacter.c

10>PropertyLoader.cpp

17>helpwindow2.c

16>uicharacterdetails.c

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiCharacter.c(63337,45): warning C4146: opérateur moins unaire appliqué à un type non signé, le résultat sera non signé

10>PropertyManager.cpp

17>helpwindownew.c

17>imekor.c

17>inputdialog.c

17>inputdialogofflineshop.c

17>inputdialogshop.c

17>inputdialogwithdescription.c

17>inputdialogwithdescription2.c

17>inventorywindow.c

17>itemcombinationwindow.c

17>keychange_window.c

17>loadingwindow.c

17>loginwindow.c

17>mailbox.c

17>mailboxlist.c

17>maintenancewindow.c

17>mallwindow.c

17>marklistwindow.c

10>RaceData.cpp

17>messengerwindow.c

17>minigameattendance.c

17>minigamecatchkinggamepage.c

10>RaceDataFile.cpp

16>uiChat.c

10>RaceManager.cpp

17>minigamecatchkingsimplewaitingpage.c

17>minigamecatchkingwaitingpage.c

17>minigamedialog.c

10>RaceMotionData.cpp

17>minigamefisheventwaitingpage.c

17>minigamefishgamepage.c

17>minigamerumigamepage.c

17>minigamerumiwaitingpage.c

10>SnowEnvironment.cpp

17>minigamewindow.c

17>minigameyutnorigamepage.c

10>SnowParticle.cpp

10>TerrainDecal.cpp

17>minigameyutnoriwaitingpage.c

17>minimap.c

10>TerrainPatch.cpp

10>TerrainQuadtree.cpp

10>WeaponTrace.cpp

17>moneyinputdialog.c

16>uiCommon.c

10>Génération de code en cours...

17>moneyinputdialognew.c

17>monstercardwindow.c

17>mousebuttonwindow.c

17>movechanneldialog.c

17>musiclistwindow.c

17>myshopdecorationwindow.c

17>newprivateshopsearch.c

17>newprivateshopsearchfilter.c

17>newtaskbar.c

16>uiCube.c

17>new_createcharacterwindow.c

17>new_inventorywindow.c

16>uicuberenewal.c

17>new_selectcharacterwindow.c

16>uidragonlairranking.c

17>offlineshopadminpanel.c

17>offlineshopbuilder.c

17>offlineshopcreatedialog.c

16>uiDragonSoul.c

16>uidungeoninfo.c

17>offlineshopdialog.c

17>offlineshopmanagerdialog.c

16>uiEquipmentDialog.c

16>uiEx.c

10>GameLib.vcxproj -> D:\binary_source\vs_files\GameLib\Release\GameLib.lib

16>uiExchange.c

17>offlineshopsaleswindow.c

17>offlineshop_banka.c

17>offlineshop_bankdialog.c

17>opengiftboxui.c

17>openofflineshopdialog.c

17>overfallnetworkcheck.c

17>partymatchwindow.c

17>partymemberinfoboard.c

17>passworddialog.c

16>uiGameButton.c

17>pethatchingwindow.c

17>petinformationwindow.c

17>petminiinformationwindow.c

17>petnamechangewindow.c

17>picketcdialog.c

16>uiGameOption.c

17>pickmoneydialog.c

17>pickoffshopmoneydialog.c

17>popupdialog.c

16>uigayanew.c

17>popupdialog2.c

17>postread.c

17>postwrite.c

17>privateshopbuilder.c

17>privateshopdialog.c

16>uigemshop.c

17>privateshopsearchdialog.c

17>questdialog.c

16>uigiveitem.c

17>questiondialog.c

17>questiondialog2.c

17>questiondialog_confirmdestroy.c

16>uiGuild.c

17>questiondropdialog.c

17>questiondropdialogitem.c

17>questiondueloptiondialog.c

17>rankingboardwindow.c

16>uiguilddragonlairranking.c

17>refinedialog.c

17>registerchallengewindow.c

17>restartdialog.c

17>rightmousebuttonwindow.c

16>uiHelp.c

17>safeboxwindow.c

17>safeboxwindow_spcinv.c

17>selectattrdialog.c

17>selectcharacterwindow.c

17>selectempirewindow.c

16>uihelp_new.c

10>Génération du projet "GameLib.vcxproj" terminée.

18>------ Début de la regénération globale : Projet : UserInterface, Configuration : Release Win32 ------

16>uiInventory.c

17>selectitemwindow.c

17>shopdialog.c

16>uimailbox.c

17>shopdialog_.c

17>skillbookcombinationdialog.c

17>skillcolorwindow.c

17>skillpointresetdialog.c

17>specialgachawindow.c

17>specialinventorywindow.c

17>systemdialog.c

17>systemdialog_formall.c

17>systemdialog_forportal.c

17>systemoptiondialog.c

17>taskbar.c

17>tradebonuscostume.c

17>usersituationnotice.c

17>weblinkedbannerwindow.c

17>webwindow.c

17>whisperdialog.c

16>uimaintenance.c

17>wndgiveitem.c

16>uiMapNameShower.c

16>uiMessenger.c

18>StdAfx.cpp

16>uiminigame.c

16>uiminigamecatchking.c

16>uiminigamerumi.c

18>D:\binary_source\source\eterLib\SkyBox.h(108,2): warning C5208: la classe sans nom utilisée dans le nom de typedef ne peut pas déclarer de membres qui ne sont pas des membres de données non statiques, des énumérations de membres ou des classes membres

16>uiMiniMap.c

16>uinewoptions.c

18>AccountConnector.cpp

16>uinewprivateshopsearch.c

18>AffectFlagContainer.cpp

18>BadgeNotificationManager.cpp

16>uiofflineshop.c

18>CameraProcedure.cpp

18>CefClientApp.cpp

17>CUiScriptLib.vcxproj -> D:\binary_source\extern\library\uiscriptlib.lib

16>uiofflineshopbuilder.c

18>CefClientHandler.cpp

18>CefClientV8ExtensionHandler.cpp

18>CefWebBrowser.cpp

18>CheckLatestFiles.cpp

18>CPythonRenderTargetModule.cpp

16>uiopengiftbox.c

16>uiOption.c

16>uiParty.c

16>uipartychallenge.c

18>GameType.cpp

18>GuildMarkDownloader.cpp

16>uipetinfo.c

16>uiPhaseCurtain.c

16>uipicketc.c

18>GuildMarkUploader.cpp

16>uiPickMoney.c

16>uiPlayerGauge.c

18>HAntiMultipleFarm.cpp

16>uiPointReset.c

16>uiPrivateShopBuilder.c

16>uiprivateshopsearch.c

18>HTSDK.cpp

18>InstanceBase.cpp

16>uiQuest.c

16>uiquestcategory.c

18>InstanceBaseBattle.cpp

16>uiRefine.c

16>uiRestart.c

16>uiSafebox.c

18>InstanceBaseEffect.cpp

16>uiScriptLocale.c

16>uiselectitem.c

16>uiselectitemex.c

16>uiSelectMusic.c

16>uiShop.c

16>uiskillcolor.c

18>InstanceBaseEvent.cpp

18>InstanceBaseMotion.cpp

16>uispecialinventory.c

16>uiswitchbot.c

18>Génération de code en cours...

16>uiSystem.c

16>uiSystemOption.c

16>uiTarget.c

16>uiTaskBar.c

18>Compilation en cours...

18>InstanceBaseMovement.cpp

16>uiTip.c

18>InstanceBaseTransform.cpp

16>uiToolTip.c

16>uitradebonuscostume.c

16>uiUploadMark.c

18>InsultChecker.cpp

18>Locale.cpp

16>uiWeb.c

16>uiWhisper.c

18>MarkImage.cpp

18>MarkManager.cpp

18>MovieMan.cpp

18>NetworkActorManager.cpp

18>PingManager.cpp

18>ProcessCRC.cpp

18>ProcessScanner.cpp

18>PythonAcce.cpp

18>PythonApplication.cpp

18>PythonApplicationCamera.cpp

18>PythonApplicationCursor.cpp

18>PythonApplicationEvent.cpp

18>PythonApplicationLogo.cpp

18>PythonApplicationModule.cpp

18>PythonApplicationProcedure.cpp

18>PythonApplicationWebPage.cpp

18>Génération de code en cours...

18>Compilation en cours...

18>PythonBackground.cpp

18>PythonBackgroundModule.cpp

18>PythonChangeLook.cpp

18>PythonCharacterManager.cpp

18>PythonCharacterManagerModule.cpp

18>PythonCharacterModule.cpp

18>PythonChat.cpp

18>PythonChatModule.cpp

18>PythonConfig.cpp

18>PythonConfigModule.cpp

18>PythonCubeRenewal.cpp

18>PythonEffectModule.cpp

18>PythonEventManager.cpp

18>PythonEventManagerMoudle.cpp

18>PythonExceptionSender.cpp

18>PythonExchange.cpp

18>PythonExchangeModule.cpp

18>PythonFlyModule.cpp

18>PythonGameEventManagerModule.cpp

18>PythonGuild.cpp

18>Génération de code en cours...

18>Compilation en cours...

18>PythonIME.cpp

18>PythonIMEModule.cpp

18>PythonItem.cpp

18>PythonItemModule.cpp

18>PythonMessenger.cpp

18>PythonMiniMap.cpp

18>PythonMiniMapModule.cpp

18>PythonNetworkStream.cpp

18>PythonNetworkStreamCommand.cpp

18>PythonNetworkStreamEvent.cpp

18>PythonNetworkStreamModule.cpp

18>PythonNetworkStreamPhaseGame.cpp

18>PythonNetworkStreamPhaseGameActor.cpp

16>CRootLib.vcxproj -> D:\binary_source\extern\library\rootlib.lib

18>PythonNetworkStreamPhaseGameItem.cpp

18>PythonNetworkStreamPhaseHandShake.cpp

18>PythonNetworkStreamPhaseLoading.cpp

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\game.c(26407): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\interfaceModule.c(25269): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\item_names_searchshop.c(56685): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\localeInfo.c(31505): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\new_introcreate.c(22590): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\new_introselect.c(22464): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\ui.c(31347): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiCharacter.c(23239): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiChat.c(23678): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiCommon.c(25503): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiDragonSoul.c(22676): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiGuild.c(26090): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiInventory.c(22965): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uimailbox.c(23772): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiMessenger.c(25865): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiminigamecatchking.c(23572): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uinewoptions.c(20632): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uinewprivateshopsearch.c(23736): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiofflineshop.c(22716): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

18>PythonNetworkStreamPhaseLogin.cpp

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uipetinfo.c(23144): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiprivateshopsearch.c(21999): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiQuest.c(22605): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiSafebox.c(23015): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uispecialinventory.c(22227): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiswitchbot.c(22739): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiSystemOption.c(25049): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiTarget.c(22063): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiTaskBar.c(23632): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiToolTip.c(25567): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>Génération du projet "CRootLib.vcxproj" terminée.

18>PythonNetworkStreamPhaseOffline.cpp

18>PythonNetworkStreamPhaseSelect.cpp

18>PythonNewPrivateShopSearch.cpp

18>Génération de code en cours...

18>Compilation en cours...

18>PythonNonPlayer.cpp

18>PythonNonPlayerModule.cpp

18>PythonPackModule.cpp

18>PythonPlayer.cpp

18>PythonPlayerEventHandler.cpp

18>PythonPlayerInput.cpp

18>PythonPlayerInputKeyboard.cpp

18>PythonPlayerInputMouse.cpp

18>PythonPlayerModule.cpp

18>PythonPlayerSettingsModule.cpp

18>PythonPlayerSkill.cpp

18>PythonPrivateShopSearch.cpp

18>PythonProfilerModule.cpp

18>PythonQuest.cpp

18>PythonrootlibManager.cpp

18>PythonSafeBox.cpp

18>PythonShop.cpp

18>PythonSkill.cpp

18>PythonSkillPet.cpp

18>PythonSoundManagerModule.cpp

18>Génération de code en cours...

18>Compilation en cours...

18>PythonSwitchbot.cpp

18>PythonSystem.cpp

18>PythonSystemModule.cpp

18>PythonTextTail.cpp

18>PythonTextTailModule.cpp

18>PythonuiscriptlibManager.cpp

18>ServerStateChecker.cpp

18>ServerStateCheckerModule.cpp

18>UserInterface.cpp

18>Génération de code en cours...

18>minIni.c

18>   Création de la bibliothèque D:\binary_source\binary\Metin2Release.lib et de l'objet D:\binary_source\binary\Metin2Release.exp

18>Génération de code en cours

18>Previous IPDB not found, fall back to full compilation.

18>All 543 functions were compiled because no usable IPDB/IOBJ from previous compilation was found.

18>Fin de la génération du code

18>UserInterface.vcxproj -> D:\binary_source\binary\Metin2Release.exe

18>Génération du projet "UserInterface.vcxproj" terminée.

========== Regénération globale : 18 a réussi, 0 a échoué, 0 a été ignoré ==========

 

Vous pouvez a présent lancer Metin2Release.exe qui se trouve dans : binary_source\binary

 

pour trouver un compte facilement aller sur navicat>mysql>user>Copier le mot de passe du compte que vous avez créer au debut, ensuite aller dans account>account>modifier le 1er account, modifier son mot de passe par le votre et voilà compte : id : ruiiur00 mdp : le votre

(ou sinon créer vous tous simplement un nouveau compte :)

 

Vous pouvez aussi déposer les source server dans votre FTP, mais pas besoin pour l'ouverture 

Bon courage à vous, et essayer de faire avancer le fil.

 

pour corriger l'erreur BSCMAKE BK4504 :

Source erreur BK4504

 

le fichier contient un trop grand nombre de références ; autres références à partir de cette source ignorées

Le fichier. cpp contient plus de 64 000 références de symboles. Lorsque BSCMAKE a rencontré 64 000 références dans un fichier, il ignore toutes les références supplémentaires.

Pour corriger le problème, fractionnez le fichier en deux ou plusieurs fichiers, chacun d’entre eux ayant moins de 64 000 références de symboles

(si quelqu'un saurais les fractionner ou trouver une solution sa serais cool)

Cordialement, Dante

Edited by Dante
  • Funky Emulation 1
  • J'adore 23
  • J'aime 3

Je recherche des personnes motivés pour un projet de Serveur Metin 2021, mpmoi

Link to comment
Il y a 21 heures, Dante a dit :

spacer.png

 

Pour ceux qui n'y arrive pas, je vais vous expliquer comment j'ai fait (en local):

(Ma méthode n'est surement pas la meilleur, mais elle à fonctionner, avec quelques bug (en compilant) que vous pourrais peux être aider à lever.)

 

--------------------------------------

1.    Assurez vous d'avoir tout ces fichier 

  Révéler le contenu masqué

---VDI FreeBSD 12.1 (Freebsd_12_1_Enix_Yazilim.rar):    LIEN

---Serverfile full (Overfall2Fixed (1).rar): LIEN

---Game + mysql (burakkk.tar.gz):             LIEN
(elle sont déjà dans l'archive "Serverfile full" mais je suis passer par ce lien pour game+mysql

La Base..
---VirtualBox : https://www.virtualbox.org/

---Visual studio 2019 Community : https://visualstudio.microsoft.com/fr/downloads/
(en installant ajouter "Développement Desktop en C++" )

---WinSCP

--------------------------------------

 

2.    Extraire : "Freebsd_12_1_Enix_Yazilim.rar" & "Overfall2Fixed (1).rar"

 

3.    Lancer VirtualBox : Outils > Nouvelle >BSD > Allouer votre RAM > disque dur virtuel existant, rechercher après "Server01.vdi"

 

4.    Paramètres > Réseau > Mode d'accès réseau : accès par pont > Choisissez votre carte > OK

 

5.    Lancer votre machine virtuel :        ID : root        PASSWD : dev

 

-On va créer nos log mysql :

 

  Révéler le contenu masqué

mysql -u root -p

ENTER            //(AUCUN MOT DE PASSE DE BASE)

 

GRANT ALL PRIVILEGES ON *.* TO 'mt2'@'localhost' IDENTIFIED BY '[email protected]#';            //Il étais de base dans "user" de Overfall, donc je les remis

 

GRANT ALL PRIVILEGES ON *.* TO 'VOTRE_ID'@'%' IDENTIFIED BY 'VOTRE_PASSWORD';        //Votre ID et Mot de passe

 

flush privileges;

 

quit

 

ifconfig

(normalement 192.168.1.100, si oui continuer, sinon je vous invite a configurer votre ip avec "bsdconfig" pour voir si tout est bien comme chez vous.

 

6.   On se connecte au FTP (pour ma part WinSCP)

  Révéler le contenu masqué

ip : 192.168.1.100  (votre IP récupéré avec ifconfig)

id : root 

pass : dev

 

6.a.    Ajouter : burakkk.tar.gz dans /usr/            //(Je le place ici pour pas écraser le mysql complétement)

sur votre machine virtuel : 

cd /usr/ 

tar zxvf burakkk.tar.gz

 

il va vous créer dans /usr/ les dossier "usr" & "var"

rentrer dans /usr/usr/ et remetter le dossier "Server" en arrière, c'est a dire dans /usr/

maintenant aller dans /usr/var/db/mysql/ puis "copier" account+common+hotbackup+log+player+test+tested

puis coller dans /var/db/mysql/

 

maintenant nous allons modifier les BIND_IP dans les CONFIG de :

  Masquer le contenu

/usr/Server/auth/CONFIG

/usr/Server/game/channel1/core1/CONFIG

/usr/Server/game/channel1/core2/CONFIG

/usr/Server/game/channel1/core3/CONFIG

/usr/Server/game/channel99/core1/CONFIG

 

modifier le BIND_IP en BIND_IP: 192.168.1.100        /(ou votre ip avec ifconfig)

 

reboot

 

vous pouvez a présent lancer votre serveur avec :

  Révéler le contenu masqué

cd /usr/Server/

sh start.sh

1

 

//SI ERROR 2002 ALORS 

  Masquer le contenu

ERROR 2002 (HY000): Can't connect To local MySQL serveur through socket "/tmp/mysql.Sock' (2)

 

Une erreur qui survient chez beaucoup de personnes qui installe le MySQL sur leurs machines.

 

Solution :

 

pwd_mkdb -p /etc/master.passwd

chown -R mysql /var/db/mysql && chgrp -R mysql /var/db/mysql

 

reboot

 

 

Chercher serverinfo.py dans :    Overfall2Fixed (1)\Overfall2Fixed\Overfall2 - Project\client_related\binary_source\binary_source\binary\__cython\root_modules

mettez votre adresse ip (ifconfig)

 

Chercher _make_uiscript.bat :     Overfall2Fixed (1)\Overfall2Fixed\Overfall2 - Project\client_related\binary_source\source\CUiScriptLib\Workplace

modifier les chemin vers les votres

 

Chercher _make_root.bat dans :    Overfall2Fixed (1)\Overfall2Fixed\Overfall2 - Project\client_related\binary_source\binary_source\source\CRootLib\Workplace

modifier les chemin vers les votres

 

Chercher client.sln dans :         Overfall2Fixed (1)\Overfall2Fixed\Overfall2 - Project\client_related\binary_source\binary_source

Ouvrir avec visual studio 2019

 

Clique droit sur CRootLib > Regénérer la Solution

vous pouvez le laisser sur place,il ces placer dans : Overfall2Fixed (1)\Overfall2Fixed\Overfall2 - Project\client_related\binary_source\extern\library\rootlib.lib

 

(pour ma part il se compile avec quelques erreur mais sa fonctionne quand même, voici mes erreurs pour CRootLib :

 

L'opération de régénération a démarré...

  Révéler le contenu masqué

1>------ Début de la régénération globale : Projet : CRootLib, Configuration : Release Win32 ------

1> Exécute le cythoniseur !

1>D:\binary_source\binary\__cython\root_modules\blend_table.py

1>D:\binary_source\binary\__cython\root_modules\colorinfo.py

1>D:\binary_source\binary\__cython\root_modules\consolemodule.py

1>D:\binary_source\binary\__cython\root_modules\constfunctions.py

1>D:\binary_source\binary\__cython\root_modules\constinfo.py

1>D:\binary_source\binary\__cython\root_modules\constinfo2.py

1>D:\binary_source\binary\__cython\root_modules\debuginfo.py

1>D:\binary_source\binary\__cython\root_modules\dragon_soul_refine_settings.py

1>D:\binary_source\binary\__cython\root_modules\emotion.py

1>D:\binary_source\binary\__cython\root_modules\exception.py

1>D:\binary_source\binary\__cython\root_modules\extended_sell.py

1>D:\binary_source\binary\__cython\root_modules\game.py

1>D:\binary_source\binary\__cython\root_modules\import_manager.py

1>D:\binary_source\binary\__cython\root_modules\interfacemodule.py

1>D:\binary_source\binary\__cython\root_modules\introcreate.py

1>D:\binary_source\binary\__cython\root_modules\introempire.py

1>D:\binary_source\binary\__cython\root_modules\introloading.py

1>D:\binary_source\binary\__cython\root_modules\intrologin.py

1>D:\binary_source\binary\__cython\root_modules\intrologo.py

1>D:\binary_source\binary\__cython\root_modules\introoverfallnetwork.py

1>D:\binary_source\binary\__cython\root_modules\introselect.py

1>D:\binary_source\binary\__cython\root_modules\item_names_searchshop.py

1>D:\binary_source\binary\__cython\root_modules\localeinfo.py

1>D:\binary_source\binary\__cython\root_modules\mousemodule.py

1>D:\binary_source\binary\__cython\root_modules\musicinfo.py

1>D:\binary_source\binary\__cython\root_modules\networkmodule.py

1>D:\binary_source\binary\__cython\root_modules\new_introcreate.py

1>D:\binary_source\binary\__cython\root_modules\new_introselect.py

1>D:\binary_source\binary\__cython\root_modules\playersettingmodule.py

1>D:\binary_source\binary\__cython\root_modules\prototype.py

1>D:\binary_source\binary\__cython\root_modules\searchprivateshop_cfg.py

1>D:\binary_source\binary\__cython\root_modules\servercommandparser.py

1>D:\binary_source\binary\__cython\root_modules\serverinfo.py

1>D:\binary_source\binary\__cython\root_modules\stringcommander.py

1>D:\binary_source\binary\__cython\root_modules\system.py

1>D:\binary_source\binary\__cython\root_modules\test_affect.py

1>D:\binary_source\binary\__cython\root_modules\ui.py

1>D:\binary_source\binary\__cython\root_modules\uiacce.py

1>D:\binary_source\binary\__cython\root_modules\uiaffectshower.py

1>D:\binary_source\binary\__cython\root_modules\uiantimultiplefarm.py

1>D:\binary_source\binary\__cython\root_modules\uiattachmetin.py

1>D:\binary_source\binary\__cython\root_modules\uiauction.py

1>D:\binary_source\binary\__cython\root_modules\uiautoban.py

1>D:\binary_source\binary\__cython\root_modules\uibufferinfo.py

1>D:\binary_source\binary\__cython\root_modules\uicandidate.py

1>D:\binary_source\binary\__cython\root_modules\uicaptcha.py

1>D:\binary_source\binary\__cython\root_modules\uichangelook.py

1>D:\binary_source\binary\__cython\root_modules\uicharacter.py

1>D:\binary_source\binary\__cython\root_modules\uicharacterdetails.py

1>D:\binary_source\binary\__cython\root_modules\uichat.py

1>D:\binary_source\binary\__cython\root_modules\uicommon.py

1>D:\binary_source\binary\__cython\root_modules\uicube.py

1>D:\binary_source\binary\__cython\root_modules\uicuberenewal.py

1>D:\binary_source\binary\__cython\root_modules\uidragonlairranking.py

1>D:\binary_source\binary\__cython\root_modules\uidragonsoul.py

1>D:\binary_source\binary\__cython\root_modules\uidungeoninfo.py

1>D:\binary_source\binary\__cython\root_modules\uiequipmentdialog.py

1>D:\binary_source\binary\__cython\root_modules\uiex.py

1>D:\binary_source\binary\__cython\root_modules\uiexchange.py

1>D:\binary_source\binary\__cython\root_modules\uigamebutton.py

1>D:\binary_source\binary\__cython\root_modules\uigameoption.py

1>D:\binary_source\binary\__cython\root_modules\uigayanew.py

1>D:\binary_source\binary\__cython\root_modules\uigemshop.py

1>D:\binary_source\binary\__cython\root_modules\uigiveitem.py

1>D:\binary_source\binary\__cython\root_modules\uiguild.py

1>D:\binary_source\binary\__cython\root_modules\uiguildragonlairranking.py

1>D:\binary_source\binary\__cython\root_modules\uihelp.py

1>D:\binary_source\binary\__cython\root_modules\uihelp_new.py

1>D:\binary_source\binary\__cython\root_modules\uiinventory.py

1>D:\binary_source\binary\__cython\root_modules\uimailbox.py

1>D:\binary_source\binary\__cython\root_modules\uimaintenance.py

1>D:\binary_source\binary\__cython\root_modules\uimapnameshower.py

1>D:\binary_source\binary\__cython\root_modules\uimessenger.py

1>D:\binary_source\binary\__cython\root_modules\uiminigame.py

1>D:\binary_source\binary\__cython\root_modules\uiminigamecatchking.py

1>D:\binary_source\binary\__cython\root_modules\uiminigamerumi.py

1>D:\binary_source\binary\__cython\root_modules\uiminimap.py

1>D:\binary_source\binary\__cython\root_modules\uinewoptions.py

1>D:\binary_source\binary\__cython\root_modules\uinewprivateshopsearch.py

1>D:\binary_source\binary\__cython\root_modules\uiofflineshop.py

1>D:\binary_source\binary\__cython\root_modules\uiofflineshopbuilder.py

1>D:\binary_source\binary\__cython\root_modules\uiopengiftbox.py

1>D:\binary_source\binary\__cython\root_modules\uioption.py

1>D:\binary_source\binary\__cython\root_modules\uiparty.py

1>D:\binary_source\binary\__cython\root_modules\uipartychallenge.py

1>D:\binary_source\binary\__cython\root_modules\uipetinfo.py

1>D:\binary_source\binary\__cython\root_modules\uiphasecurtain.py

1>D:\binary_source\binary\__cython\root_modules\uipicketc.py

1>D:\binary_source\binary\__cython\root_modules\uipickmoney.py

1>D:\binary_source\binary\__cython\root_modules\uiplayergauge.py

1>D:\binary_source\binary\__cython\root_modules\uipointreset.py

1>D:\binary_source\binary\__cython\root_modules\uiprivateshopbuilder.py

1>D:\binary_source\binary\__cython\root_modules\uiprivateshopsearch.py

1>D:\binary_source\binary\__cython\root_modules\uiquest.py

1>D:\binary_source\binary\__cython\root_modules\uiquestcategory.py

1>D:\binary_source\binary\__cython\root_modules\uirefine.py

1>D:\binary_source\binary\__cython\root_modules\uirestart.py

1>D:\binary_source\binary\__cython\root_modules\uisafebox.py

1>D:\binary_source\binary\__cython\root_modules\uiscriptlocale.py

1>D:\binary_source\binary\__cython\root_modules\uiselectitem.py

1>D:\binary_source\binary\__cython\root_modules\uiselectitemex.py

1>D:\binary_source\binary\__cython\root_modules\uiselectmusic.py

1>D:\binary_source\binary\__cython\root_modules\uishop.py

1>D:\binary_source\binary\__cython\root_modules\uiskillcolor.py

1>D:\binary_source\binary\__cython\root_modules\uispecialinventory.py

1>D:\binary_source\binary\__cython\root_modules\uiswitchbot.py

1>D:\binary_source\binary\__cython\root_modules\uisystem.py

1>D:\binary_source\binary\__cython\root_modules\uisystemoption.py

1>D:\binary_source\binary\__cython\root_modules\uitarget.py

1>D:\binary_source\binary\__cython\root_modules\uitaskbar.py

1>D:\binary_source\binary\__cython\root_modules\uitip.py

1>D:\binary_source\binary\__cython\root_modules\uitooltip.py

1>D:\binary_source\binary\__cython\root_modules\uitradebonuscostume.py

1>D:\binary_source\binary\__cython\root_modules\uiuploadmark.py

1>D:\binary_source\binary\__cython\root_modules\uiweb.py

1>D:\binary_source\binary\__cython\root_modules\uiwhisper.py

1> 116 fichier(s) copié(s).

1> copie terminée

1> PythonrootlibManager créé avec succès.

1>Appuyez sur une touche pour continuer...

1>blend_table.c

1>colorInfo.c

1>ConsoleModule.c

1>constfunctions.c

1>constInfo.c

1>constinfo2.c

1> debugInfo.c

1>dragon_soul_refine_settings.c

1> émotion.c

1>exception.c

1>vente_étendue.c

1>jeu.c

1> gestionnaire_import.c

1> interfaceModule.c

1>introCréer.c

1>introEmpire.c

1>introChargement.c

1>introLogin.c

1> introLogo.c

1>introoverfallnetwork.c

1>introSelect.c

1>item_names_searchshop.c

1>localInfo.c

1> module.c

1>musicInfo.c

1> module de réseau.c

1>nouveau_introcreate.c

1>nouveau_introselect.c

1>playerSettingModule.c

1>Prototype.c

1>searchprivateshop_cfg.c

1>serverCommandParser.c

1>serverInfo.c

1>stringCommander.c

1> système.c

1> test_affect.c

1>ui.c

1>uiacce.c

1>uiAffectDouche.c

1>uiantimultiplefarm.c

1>uiAttachMetin.c

1> uiAuction.c

1>uiAutoban.c

1>uibufferinfo.c

1>uiCandidate.c

1>uicaptcha.c

1> uichangelook.c

1>uiCharacter.c

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiCharacter.c(63337.45): warning C4146: opérateur moins unaire appliqué à un type non signé, le résultat sera non signé

1>uicharacterdetails.c

1>uiChat.c

1>uiCommon.c

1>uiCube.c

1>uicubernewal.c

1>uidragonlairranking.c

1> uiDragonSoul.c

1>uidungeoninfo.c

1>uiEquipmentDialog.c

1>uiEx.c

1>uiExchange.c

1> uiGameButton.c

1>uiGameOption.c

1>uigayanew.c

1>uigemshop.c

1>uigiveitem.c

1>uiGuilde.c

1>uiguilddragonlairranking.c

1> uiHelp.c

1>uihelp_new.c

1>uiInventaire.c

1>uimailbox.c

1>uimaintenance.c

1>uiMapNameShower.c

1>uiMessenger.c

1> uiminigame.c

1>uiminigamecatchking.c

1>uiminigamerumi.c

1>uiMiniMap.c

1> uinewoptions.c

1>uinewprivateshopsearch.c

1>uiofflineshop.c

1>uiofflineshopbuilder.c

1>uiopengiftbox.c

1>uiOption.c

1> uiPartie.c

1>uipartychallenge.c

1>uipetinfo.c

1> uiPhaseCurtain.c

1>uipicketc.c

1>uiPickMoney.c

1>uiPlayerGauge.c

1>uiPointReset.c

1>uiPrivateShopBuilder.c

1>uiprivateshopsearch.c

1>uiQuest.c

1> uiquestcategory.c

1>uiAffiner.c

1>uiRestart.c

1>uiSafebox.c

1>uiScriptLocale.c

1>uiselectitem.c

1>uiselectitemex.c

1>uiSelectMusic.c

1>uiShop.c

1>uiskillcolor.c

1>uispecialinventory.c

1>uiswitchbot.c

1>uiSystem.c

1>uiSystemOption.c

1>uiTarget.c

1>uiTaskBar.c

1>uiTip.c

1>uiToolTip.c

1>uitradebonuscostume.c

1>uiUploadMark.c

1>uiWeb.c

1>uiWhisper.c

1>CRootLib.vcxproj -> D:\binary_source\extern\library\rootlib.lib

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\game.c(26407): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\interfaceModule.c(25269): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\item_names_searchshop.c(56685): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\localeInfo.c(31505): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\new_introcreate.c(22590): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\new_introselect.c(22464): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\ui.c(31347): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiCharacter.c(23239): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiChat.c(23678): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiCommon.c(25503): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiDragonSoul.c(22676): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiGuild.c(26090): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiInventory.c(22965): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uimailbox.c(23772): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiMessenger.c(25865) : avertissement BK4504 : le fichier contient trop de rÚfÚrencesá ; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiminigamecatchking.c(23572): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uinewoptions.c(20632): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uinewprivateshopsearch.c(23736): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiofflineshop.c(22716): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uipetinfo.c(23144): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiprivateshopsearch.c(21999): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiQuest.c(22605): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiSafebox.c(23015): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uispecialinventory.c(22227): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiswitchbot.c(22739): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiSystemOption.c(25049): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiTarget.c(22063): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiTaskBar.c(23632): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiToolTip.c(25567): warning BK4504: le fichier contient trop de rÚfÚrencesá; Les rfÚrences ultrieures provenant de cette source seront ignorÚes

1>Génération du Projet "CRootLib.vcxproj" terminée.

========== Régénération globale : 1 a réussi, 0 a échoué, 0 a été ignoré ==========

 

 

ensuite regenerer la solution complete de " Solution 'client'

 

mes erreur en compilant(mais sa fonctionne !)

 

L'opération de regénération a démarré...

  Révéler le contenu masqué

1>------ Début de la regénération globale : Projet : EterLocale, Configuration : Release Win32 ------

2>------ Début de la regénération globale : Projet : CWebBrowser, Configuration : Release Win32 ------

3>------ Début de la regénération globale : Projet : EffectLib, Configuration : Release Win32 ------

4>------ Début de la regénération globale : Projet : EterBase, Configuration : Release Win32 ------

1>StdAfx.cpp

1>Arabic.cpp

1>Japanese.cpp

1>StringCodec.cpp

1>StringCodec_Vietnamese.cpp

1>Génération de code en cours...

1>EterLocale.vcxproj -> D:\binary_source\vs_files\EterLocale\Release\EterLocale.lib

5>------ Début de la regénération globale : Projet : EterGrnLib, Configuration : Release Win32 ------

4>StdAfx.cpp

2>CWebBrowser.c

5>StdAfx.cpp

2>CWebBrowser.vcxproj -> D:\binary_source\vs_files\CWebBrowser\Release\CWebBrowser.lib

3>StdAfx.cpp

6>------ Début de la regénération globale : Projet : EterImageLib, Configuration : Release Win32 ------

5>LODController.cpp

6>StdAfx.cpp

5>Material.cpp

5>Mesh.cpp

5>Model.cpp

5>ModelInstance.cpp

5>ModelInstanceCollisionDetection.cpp

5>ModelInstanceModel.cpp

6>DXTCImage.cpp

6>Image.cpp

6>TGAImage.cpp

6>Génération de code en cours...

5>ModelInstanceMotion.cpp

5>ModelInstanceRender.cpp

6>EterImageLib.vcxproj -> D:\binary_source\vs_files\EterImageLib\Release\EterImageLib.lib

7>------ Début de la regénération globale : Projet : EterLib, Configuration : Release Win32 ------

5>ModelInstanceUpdate.cpp

5>Motion.cpp

5>Thing.cpp

5>ThingInstance.cpp

7>StdAfx.cpp

5>Util.cpp

5>Génération de code en cours...

7>AttributeData.cpp

4>cipher.cpp

4>CPostIt.cpp

4>CRC32.cpp

4>Debug.cpp

4>error.cpp

4>FileBase.cpp

4>FileDir.cpp

4>FileLoader.cpp

4>lzo.cpp

4>MappedFile.cpp

4>Base.cpp

4>Poly.cpp

4>Symbol.cpp

4>SymTable.cpp

4>Random.cpp

4>Stl.cpp

4>tea.cpp

4>TempFile.cpp

4>Timer.cpp

4>Utils.cpp

4>Génération de code en cours...

7>AttributeInstance.cpp

3>EffectData.cpp

3>EffectElementBase.cpp

3>EffectElementBaseInstance.cpp

3>EffectInstance.cpp

3>EffectManager.cpp

3>EffectMesh.cpp

3>EffectMeshInstance.cpp

3>EffectUpdateDecorator.cpp

3>EmitterProperty.cpp

3>FrameController.cpp

3>ParticleInstance.cpp

3>ParticleProperty.cpp

3>ParticleSystemData.cpp

3>ParticleSystemInstance.cpp

3>SimpleLightData.cpp

5>EterGrnLib.vcxproj -> D:\binary_source\vs_files\EterGrnLib\Release\EterGrnLib.lib

8>------ Début de la regénération globale : Projet : EterPack, Configuration : Release Win32 ------

3>SimpleLightInstance.cpp

7>BlockTexture.cpp

4>EterBase.vcxproj -> D:\binary_source\vs_files\EterBase\Release\EterBase.lib

3>Type.cpp

7>Camera.cpp

9>------ Début de la regénération globale : Projet : EterPythonLib, Configuration : Release Win32 ------

3>Génération de code en cours...

7>CollisionData.cpp

7>ColorTransitionHelper.cpp

7>CRenderTarget.cpp

7>D:\binary_source\source\eterLib\SkyBox.h(108,2): warning C5208: la classe sans nom utilisée dans le nom de typedef ne peut pas déclarer de membres qui ne sont pas des membres de données non statiques, des énumérations de membres ou des classes membres

9>StdAfx.cpp

7>CRenderTargetManager.cpp

7>CullingManager.cpp

7>Decal.cpp

7>DibBar.cpp

7>EnvironmentMap.cpp

7>FileLoaderThread.cpp

8>EterPack.cpp

8>EterPackCursor.cpp

9>PythonGraphic.cpp

9>PythonGraphicImageModule.cpp

9>PythonGraphicModule.cpp

7>GrpBase.cpp

9>PythonGraphicTextModule.cpp

3>EffectLib.vcxproj -> D:\binary_source\vs_files\EffectLib\Release\EffectLib.lib

7>GrpCollisionObject.cpp

10>------ Début de la regénération globale : Projet : GameLib, Configuration : Release Win32 ------

9>PythonGraphicThingModule.cpp

9>PythonGridSlotWindow.cpp

7>GrpColor.cpp

7>GrpColorInstance.cpp

7>GrpD3DXBuffer.cpp

9>PythonSlotWindow.cpp

7>GrpDetector.cpp

9>PythonWindow.cpp

7>GrpDevice.cpp

9>PythonWindowManager.cpp

7>Génération de code en cours...

9>PythonWindowManagerModule.cpp

9>Génération de code en cours...

7>Compilation en cours...

7>GrpDIB.cpp

7>GrpExpandedImageInstance.cpp

10>StdAfx.cpp

8>EterPackManager.cpp

10>D:\binary_source\source\eterLib\SkyBox.h(108,2): warning C5208: la classe sans nom utilisée dans le nom de typedef ne peut pas déclarer de membres qui ne sont pas des membres de données non statiques, des énumérations de membres ou des classes membres

7>GrpFontTexture.cpp

10>ActorInstance.cpp

8>EterPackPolicy_CSHybridCrypt.cpp

7>GrpImage.cpp

9>EterPythonLib.vcxproj -> D:\binary_source\vs_files\EterPythonLib\Release\EterPythonLib.lib

11>------ Début de la regénération globale : Projet : MilesLib, Configuration : Release Win32 ------

7>GrpImageInstance.cpp

7>GrpImageTexture.cpp

10>ActorInstanceAttach.cpp

7>GrpIndexBuffer.cpp

11>Stdafx.cpp

7>GrpLightManager.cpp

10>ActorInstanceBattle.cpp

7>GrpMarkInstance.cpp

8>StdAfx.cpp

7>GrpMath.cpp

7>GrpObjectInstance.cpp

7>GrpPixelShader.cpp

7>GrpRatioInstance.cpp

7>GrpRenderTargetTexture.cpp

7>GrpScreen.cpp

10>ActorInstanceBlend.cpp

7>GrpShadowTexture.cpp

7>GrpSubImage.cpp

8>Génération de code en cours...

7>GrpText.cpp

7>GrpTextInstance.cpp

10>ActorInstanceCollisionDetection.cpp

7>GrpTexture.cpp

7>Génération de code en cours...

11>SoundBase.cpp

11>SoundData.cpp

11>SoundInstance2D.cpp

11>SoundInstance3D.cpp

11>SoundInstanceStream.cpp

11>SoundManager.cpp

11>SoundManager2D.cpp

11>SoundManager3D.cpp

11>SoundManagerStream.cpp

11>Type.cpp

11>Génération de code en cours...

8>md5.c

11>MilesLib.vcxproj -> D:\binary_source\vs_files\MilesLib\Release\MilesLib.lib

12>------ Début de la regénération globale : Projet : PRTerrainLib, Configuration : Release Win32 ------

8>EterPack.vcxproj -> D:\binary_source\vs_files\EterPack\Release\EterPack.lib

12>StdAfx.cpp

7>Compilation en cours...

7>GrpVertexBuffer.cpp

7>GrpVertexBufferDynamic.cpp

7>GrpVertexBufferStatic.cpp

7>GrpVertexShader.cpp

7>IME.cpp

7>Input.cpp

7>JpegFile.cpp

7>LensFlare.cpp

7>lineintersect_utils.cpp

7>MSApplication.cpp

13>------ Début de la regénération globale : Projet : ScriptLib, Configuration : Release Win32 ------

10>ActorInstanceData.cpp

10>ActorInstanceEvent.cpp

7>MSWindow.cpp

10>ActorInstanceFly.cpp

12>Terrain.cpp

10>ActorInstanceMotion.cpp

12>TextureSet.cpp

12>Génération de code en cours...

13>StdAfx.cpp

7>Mutex.cpp

10>ActorInstanceMotionEvent.cpp

7>NetAddress.cpp

7>NetDatagram.cpp

7>NetDatagramReceiver.cpp

7>NetDatagramSender.cpp

7>NetDevice.cpp

7>NetPacketHeaderMap.cpp

7>NetStream.cpp

7>parser.cpp

7>Génération de code en cours...

7>Compilation en cours...

7>PathStack.cpp

7>ReferenceObject.cpp

7>Resource.cpp

12>TerrainLib.vcxproj -> D:\binary_source\vs_files\TerrainLib\Release\PRTerrainLib.lib

14>------ Début de la regénération globale : Projet : SpeedTreeLib, Configuration : Release Win32 ------

14>StdAfx.cpp

10>ActorInstancePosition.cpp

10>ActorInstanceRender.cpp

14>BoundaryShapeManager.cpp

14>SpeedGrassRT.cpp

14>SpeedGrassWrapper.cpp

14>SpeedTreeForest.cpp

10>ActorInstanceRotation.cpp

13>PythonDebugModule.cpp

7>ResourceManager.cpp

7>ScreenFilter.cpp

7>SkyBox.cpp

7>D:\binary_source\source\EterLib\SkyBox.h(108,2): warning C5208: la classe sans nom utilisée dans le nom de typedef ne peut pas déclarer de membres qui ne sont pas des membres de données non statiques, des énumérations de membres ou des classes membres

7>StateManager.cpp

7>TargaResource.cpp

7>TextBar.cpp

13>PythonLauncher.cpp

13>PythonMarshal.cpp

13>PythonUtils.cpp

13>Resource.cpp

13>D:\binary_source\source\eterLib\SkyBox.h(108,2): warning C5208: la classe sans nom utilisée dans le nom de typedef ne peut pas déclarer de membres qui ne sont pas des membres de données non statiques, des énumérations de membres ou des classes membres

13>Génération de code en cours...

7>TextFileLoader.cpp

13>ScriptLib.vcxproj -> D:\binary_source\vs_files\ScriptLib\Release\ScriptLib.lib

13>Génération du projet "ScriptLib.vcxproj" terminée.

15>------ Début de la regénération globale : Projet : SphereLib, Configuration : Release Win32 ------

14>SpeedTreeForestDirectX8.cpp

10>ActorInstanceSync.cpp

14>SpeedTreeWrapper.cpp

14>Génération de code en cours...

7>TextTag.cpp

10>ActorInstanceWeaponTrace.cpp

7>Thread.cpp

14>SpeedTreeLib.vcxproj -> D:\binary_source\vs_files\SpeedTreeLib\Release\SpeedTreeLib.lib

16>------ Début de la regénération globale : Projet : CRootLib, Configuration : Release Win32 ------

7>Util.cpp

16>Executes the cythonizer!

10>Area.cpp

16>D:\binary_source\binary\__cython\root_modules\blend_table.py

16>D:\binary_source\binary\__cython\root_modules\colorinfo.py

16>D:\binary_source\binary\__cython\root_modules\consolemodule.py

16>D:\binary_source\binary\__cython\root_modules\constfunctions.py

16>D:\binary_source\binary\__cython\root_modules\constinfo.py

16>D:\binary_source\binary\__cython\root_modules\constinfo2.py

16>D:\binary_source\binary\__cython\root_modules\debuginfo.py

16>D:\binary_source\binary\__cython\root_modules\dragon_soul_refine_settings.py

16>D:\binary_source\binary\__cython\root_modules\emotion.py

16>D:\binary_source\binary\__cython\root_modules\exception.py

16>D:\binary_source\binary\__cython\root_modules\extended_sell.py

15>StdAfx.cpp

16>D:\binary_source\binary\__cython\root_modules\game.py

16>D:\binary_source\binary\__cython\root_modules\import_manager.py

16>D:\binary_source\binary\__cython\root_modules\interfacemodule.py

7>Génération de code en cours...

16>D:\binary_source\binary\__cython\root_modules\introcreate.py

16>D:\binary_source\binary\__cython\root_modules\introempire.py

16>D:\binary_source\binary\__cython\root_modules\introloading.py

16>D:\binary_source\binary\__cython\root_modules\intrologin.py

16>D:\binary_source\binary\__cython\root_modules\intrologo.py

16>D:\binary_source\binary\__cython\root_modules\introoverfallnetwork.py

16>D:\binary_source\binary\__cython\root_modules\introselect.py

16>D:\binary_source\binary\__cython\root_modules\item_names_searchshop.py

16>D:\binary_source\binary\__cython\root_modules\localeinfo.py

16>D:\binary_source\binary\__cython\root_modules\mousemodule.py

16>D:\binary_source\binary\__cython\root_modules\musicinfo.py

16>D:\binary_source\binary\__cython\root_modules\networkmodule.py

16>D:\binary_source\binary\__cython\root_modules\new_introcreate.py

16>D:\binary_source\binary\__cython\root_modules\new_introselect.py

16>D:\binary_source\binary\__cython\root_modules\playersettingmodule.py

16>D:\binary_source\binary\__cython\root_modules\prototype.py

16>D:\binary_source\binary\__cython\root_modules\searchprivateshop_cfg.py

16>D:\binary_source\binary\__cython\root_modules\servercommandparser.py

16>D:\binary_source\binary\__cython\root_modules\serverinfo.py

16>D:\binary_source\binary\__cython\root_modules\stringcommander.py

16>D:\binary_source\binary\__cython\root_modules\system.py

16>D:\binary_source\binary\__cython\root_modules\test_affect.py

16>D:\binary_source\binary\__cython\root_modules\ui.py

16>D:\binary_source\binary\__cython\root_modules\uiacce.py

15>frustum.cpp

15>sphere.cpp

15>spherepack.cpp

15>Génération de code en cours...

16>D:\binary_source\binary\__cython\root_modules\uiaffectshower.py

16>D:\binary_source\binary\__cython\root_modules\uiantimultiplefarm.py

16>D:\binary_source\binary\__cython\root_modules\uiattachmetin.py

16>D:\binary_source\binary\__cython\root_modules\uiauction.py

16>D:\binary_source\binary\__cython\root_modules\uiautoban.py

16>D:\binary_source\binary\__cython\root_modules\uibufferinfo.py

16>D:\binary_source\binary\__cython\root_modules\uicandidate.py

16>D:\binary_source\binary\__cython\root_modules\uicaptcha.py

16>D:\binary_source\binary\__cython\root_modules\uichangelook.py

16>D:\binary_source\binary\__cython\root_modules\uicharacter.py

16>D:\binary_source\binary\__cython\root_modules\uicharacterdetails.py

16>D:\binary_source\binary\__cython\root_modules\uichat.py

16>D:\binary_source\binary\__cython\root_modules\uicommon.py

16>D:\binary_source\binary\__cython\root_modules\uicube.py

16>D:\binary_source\binary\__cython\root_modules\uicuberenewal.py

16>D:\binary_source\binary\__cython\root_modules\uidragonlairranking.py

16>D:\binary_source\binary\__cython\root_modules\uidragonsoul.py

16>D:\binary_source\binary\__cython\root_modules\uidungeoninfo.py

16>D:\binary_source\binary\__cython\root_modules\uiequipmentdialog.py

16>D:\binary_source\binary\__cython\root_modules\uiex.py

16>D:\binary_source\binary\__cython\root_modules\uiexchange.py

16>D:\binary_source\binary\__cython\root_modules\uigamebutton.py

15>SphereLib.vcxproj -> D:\binary_source\vs_files\SphereLib\Release\SphereLib.lib

17>------ Début de la regénération globale : Projet : CUiScriptLib, Configuration : Release Win32 ------

16>D:\binary_source\binary\__cython\root_modules\uigameoption.py

16>D:\binary_source\binary\__cython\root_modules\uigayanew.py

16>D:\binary_source\binary\__cython\root_modules\uigemshop.py

16>D:\binary_source\binary\__cython\root_modules\uigiveitem.py

16>D:\binary_source\binary\__cython\root_modules\uiguild.py

16>D:\binary_source\binary\__cython\root_modules\uiguilddragonlairranking.py

16>D:\binary_source\binary\__cython\root_modules\uihelp.py

16>D:\binary_source\binary\__cython\root_modules\uihelp_new.py

16>D:\binary_source\binary\__cython\root_modules\uiinventory.py

16>D:\binary_source\binary\__cython\root_modules\uimailbox.py

16>D:\binary_source\binary\__cython\root_modules\uimaintenance.py

16>D:\binary_source\binary\__cython\root_modules\uimapnameshower.py

16>D:\binary_source\binary\__cython\root_modules\uimessenger.py

16>D:\binary_source\binary\__cython\root_modules\uiminigame.py

16>D:\binary_source\binary\__cython\root_modules\uiminigamecatchking.py

16>D:\binary_source\binary\__cython\root_modules\uiminigamerumi.py

16>D:\binary_source\binary\__cython\root_modules\uiminimap.py

16>D:\binary_source\binary\__cython\root_modules\uinewoptions.py

16>D:\binary_source\binary\__cython\root_modules\uinewprivateshopsearch.py

16>D:\binary_source\binary\__cython\root_modules\uiofflineshop.py

16>D:\binary_source\binary\__cython\root_modules\uiofflineshopbuilder.py

16>D:\binary_source\binary\__cython\root_modules\uiopengiftbox.py

16>D:\binary_source\binary\__cython\root_modules\uioption.py

16>D:\binary_source\binary\__cython\root_modules\uiparty.py

16>D:\binary_source\binary\__cython\root_modules\uipartychallenge.py

16>D:\binary_source\binary\__cython\root_modules\uipetinfo.py

17>Executes the cythonizer!

16>D:\binary_source\binary\__cython\root_modules\uiphasecurtain.py

16>D:\binary_source\binary\__cython\root_modules\uipicketc.py

17>D:\binary_source\binary\__cython\uiscript_modules\acceptguildwardialog.py

16>D:\binary_source\binary\__cython\root_modules\uipickmoney.py

16>D:\binary_source\binary\__cython\root_modules\uiplayergauge.py

16>D:\binary_source\binary\__cython\root_modules\uipointreset.py

16>D:\binary_source\binary\__cython\root_modules\uiprivateshopbuilder.py

16>D:\binary_source\binary\__cython\root_modules\uiprivateshopsearch.py

17>D:\binary_source\binary\__cython\uiscript_modules\acce_absorbwindow.py

16>D:\binary_source\binary\__cython\root_modules\uiquest.py

17>D:\binary_source\binary\__cython\uiscript_modules\acce_combinewindow.py

16>D:\binary_source\binary\__cython\root_modules\uiquestcategory.py

16>D:\binary_source\binary\__cython\root_modules\uirefine.py

17>D:\binary_source\binary\__cython\uiscript_modules\antimultiplefarmwindow.py

16>D:\binary_source\binary\__cython\root_modules\uirestart.py

16>D:\binary_source\binary\__cython\root_modules\uisafebox.py

16>D:\binary_source\binary\__cython\root_modules\uiscriptlocale.py

16>D:\binary_source\binary\__cython\root_modules\uiselectitem.py

16>D:\binary_source\binary\__cython\root_modules\uiselectitemex.py

16>D:\binary_source\binary\__cython\root_modules\uiselectmusic.py

16>D:\binary_source\binary\__cython\root_modules\uishop.py

17>D:\binary_source\binary\__cython\uiscript_modules\atlaswindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\attachstonedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\auctionwindow.py

16>D:\binary_source\binary\__cython\root_modules\uiskillcolor.py

17>D:\binary_source\binary\__cython\uiscript_modules\auctionwindow_listpage.py

16>D:\binary_source\binary\__cython\root_modules\uispecialinventory.py

16>D:\binary_source\binary\__cython\root_modules\uiswitchbot.py

17>D:\binary_source\binary\__cython\uiscript_modules\auctionwindow_registerpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\auctionwindow_uniqueauctionpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\autowindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\battlefieldwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\bead.py

17>D:\binary_source\binary\__cython\uiscript_modules\beltinventorywindow.py

16>D:\binary_source\binary\__cython\root_modules\uisystem.py

16>D:\binary_source\binary\__cython\root_modules\uisystemoption.py

17>D:\binary_source\binary\__cython\uiscript_modules\bufferinfowindow.py

16>D:\binary_source\binary\__cython\root_modules\uitarget.py

16>D:\binary_source\binary\__cython\root_modules\uitaskbar.py

17>D:\binary_source\binary\__cython\uiscript_modules\buildguildbuildingchangewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\buildguildbuildingwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\captchadialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\changegradenamedialog.py

16>D:\binary_source\binary\__cython\root_modules\uitip.py

16>D:\binary_source\binary\__cython\root_modules\uitooltip.py

16>D:\binary_source\binary\__cython\root_modules\uitradebonuscostume.py

17>D:\binary_source\binary\__cython\uiscript_modules\changelookwindow.py

16>D:\binary_source\binary\__cython\root_modules\uiuploadmark.py

16>D:\binary_source\binary\__cython\root_modules\uiweb.py

16>D:\binary_source\binary\__cython\root_modules\uiwhisper.py

17>D:\binary_source\binary\__cython\uiscript_modules\changepassworddialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\characterdetailswindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\characterwindow.py

16>      116 fichier(s) copié(s).

16>copy completed

17>D:\binary_source\binary\__cython\uiscript_modules\characterwindowbonusstruct.py

17>D:\binary_source\binary\__cython\uiscript_modules\connectingdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\costumewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\createcharacterwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\cuberenewalwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\cuberesultwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\cubewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\declareguildwardialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\declareguildwarselectdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\dragonsoulattr.py

17>D:\binary_source\binary\__cython\uiscript_modules\dragonsoulrefinewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\dragonsoulwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\dungeoninfowindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\dungeonrankingwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\energybar.py

17>D:\binary_source\binary\__cython\uiscript_modules\equipmentdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\exchangedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\exchangedialog_new.py

17>D:\binary_source\binary\__cython\uiscript_modules\expandedmoneytaskbar.py

17>D:\binary_source\binary\__cython\uiscript_modules\expandedtaskbar.py

17>D:\binary_source\binary\__cython\uiscript_modules\fishingwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\gameoptiondialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\gameoptiondialog_formobile.py

17>D:\binary_source\binary\__cython\uiscript_modules\gamewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\gayarenewal.py

17>D:\binary_source\binary\__cython\uiscript_modules\gemshopwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\giftbox.py

17>D:\binary_source\binary\__cython\uiscript_modules\guilddonatedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildlanddealdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildlanddealvotedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildpopupdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildresultpopupdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildvotepopupdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildvotepopupdialog2.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_baseinfopage.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_bcp.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_boardpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_gradepage.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildbank.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildbanklog.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guilddragonlairranking.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildinfopage.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildinfopage_eu.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildinfopage_jp.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildlistwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildrankingwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_guildskillpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_memberpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\guildwindow_warscoreboard.py

17>D:\binary_source\binary\__cython\uiscript_modules\helpwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\helpwindow2.py

17>D:\binary_source\binary\__cython\uiscript_modules\helpwindownew.py

17>D:\binary_source\binary\__cython\uiscript_modules\imekor.py

17>D:\binary_source\binary\__cython\uiscript_modules\inputdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\inputdialogofflineshop.py

17>D:\binary_source\binary\__cython\uiscript_modules\inputdialogshop.py

17>D:\binary_source\binary\__cython\uiscript_modules\inputdialogwithdescription.py

17>D:\binary_source\binary\__cython\uiscript_modules\inputdialogwithdescription2.py

17>D:\binary_source\binary\__cython\uiscript_modules\inventorywindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\itemcombinationwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\keychange_window.py

17>D:\binary_source\binary\__cython\uiscript_modules\loadingwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\loginwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\mailbox.py

17>D:\binary_source\binary\__cython\uiscript_modules\mailboxlist.py

17>D:\binary_source\binary\__cython\uiscript_modules\maintenancewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\mallwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\marklistwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\messengerwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigameattendance.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamecatchkinggamepage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamecatchkingsimplewaitingpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamecatchkingwaitingpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamefisheventwaitingpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamefishgamepage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamerumigamepage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamerumiwaitingpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigamewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigameyutnorigamepage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minigameyutnoriwaitingpage.py

17>D:\binary_source\binary\__cython\uiscript_modules\minimap.py

16>PythonrootlibManager successfully created.

16>Appuyez sur une touche pour continuer...

17>D:\binary_source\binary\__cython\uiscript_modules\moneyinputdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\moneyinputdialognew.py

17>D:\binary_source\binary\__cython\uiscript_modules\monstercardwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\mousebuttonwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\movechanneldialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\musiclistwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\myshopdecorationwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\newprivateshopsearch.py

17>D:\binary_source\binary\__cython\uiscript_modules\newprivateshopsearchfilter.py

17>D:\binary_source\binary\__cython\uiscript_modules\newtaskbar.py

17>D:\binary_source\binary\__cython\uiscript_modules\new_createcharacterwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\new_inventorywindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\new_selectcharacterwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshopadminpanel.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshopbuilder.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshopcreatedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshopdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshopmanagerdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshopsaleswindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshop_banka.py

17>D:\binary_source\binary\__cython\uiscript_modules\offlineshop_bankdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\opengiftboxui.py

17>D:\binary_source\binary\__cython\uiscript_modules\openofflineshopdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\overfallnetworkcheck.py

17>D:\binary_source\binary\__cython\uiscript_modules\partymatchwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\partymemberinfoboard.py

17>D:\binary_source\binary\__cython\uiscript_modules\passworddialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\pethatchingwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\petinformationwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\petminiinformationwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\petnamechangewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\picketcdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\pickmoneydialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\pickoffshopmoneydialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\popupdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\popupdialog2.py

17>D:\binary_source\binary\__cython\uiscript_modules\postread.py

17>D:\binary_source\binary\__cython\uiscript_modules\postwrite.py

17>D:\binary_source\binary\__cython\uiscript_modules\privateshopbuilder.py

17>D:\binary_source\binary\__cython\uiscript_modules\privateshopdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\privateshopsearchdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\questdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\questiondialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\questiondialog2.py

17>D:\binary_source\binary\__cython\uiscript_modules\questiondialog_confirmdestroy.py

17>D:\binary_source\binary\__cython\uiscript_modules\questiondropdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\questiondropdialogitem.py

17>D:\binary_source\binary\__cython\uiscript_modules\questiondueloptiondialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\rankingboardwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\refinedialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\registerchallengewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\restartdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\rightmousebuttonwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\safeboxwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\safeboxwindow_spcinv.py

17>D:\binary_source\binary\__cython\uiscript_modules\selectattrdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\selectcharacterwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\selectempirewindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\selectitemwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\shopdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\shopdialog_.py

17>D:\binary_source\binary\__cython\uiscript_modules\skillbookcombinationdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\skillcolorwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\skillpointresetdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\specialgachawindow.py

10>AreaLoaderThread.cpp

17>D:\binary_source\binary\__cython\uiscript_modules\specialinventorywindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\systemdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\systemdialog_formall.py

17>D:\binary_source\binary\__cython\uiscript_modules\systemdialog_forportal.py

17>D:\binary_source\binary\__cython\uiscript_modules\systemoptiondialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\taskbar.py

17>D:\binary_source\binary\__cython\uiscript_modules\tradebonuscostume.py

17>D:\binary_source\binary\__cython\uiscript_modules\usersituationnotice.py

17>D:\binary_source\binary\__cython\uiscript_modules\weblinkedbannerwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\webwindow.py

17>D:\binary_source\binary\__cython\uiscript_modules\whisperdialog.py

17>D:\binary_source\binary\__cython\uiscript_modules\wndgiveitem.py

17>      183 fichier(s) copié(s).

17>copy completed

10>AreaTerrain.cpp

16>blend_table.c

16>colorInfo.c

16>consoleModule.c

16>constfunctions.c

16>constInfo.c

16>constinfo2.c

16>debugInfo.c

16>dragon_soul_refine_settings.c

16>emotion.c

16>exception.c

16>extended_sell.c

16>game.c

16>import_manager.c

16>interfaceModule.c

10>DragonSoulTable.cpp

16>introCreate.c

10>DungeonBlock.cpp

10>Génération de code en cours...

17>PythonuiscriptlibManager successfully created.

16>introEmpire.c

17>Appuyez sur une touche pour continuer...

16>introLoading.c

16>introLogin.c

16>introLogo.c

16>introoverfallnetwork.c

16>introSelect.c

17>Prototype.c

10>Compilation en cours...

10>FlyingData.cpp

10>FlyingInstance.cpp

16>item_names_searchshop.c

16>localeInfo.c

16>mouseModule.c

10>FlyingObjectManager.cpp

17>system.c

17>acceptguildwardialog.c

17>acce_absorbwindow.c

17>acce_combinewindow.c

17>antimultiplefarmwindow.c

17>atlaswindow.c

17>attachstonedialog.c

17>auctionwindow.c

17>auctionwindow_listpage.c

17>auctionwindow_registerpage.c

17>auctionwindow_uniqueauctionpage.c

17>autowindow.c

17>battlefieldwindow.c

17>bead.c

17>beltinventorywindow.c

17>bufferinfowindow.c

17>buildguildbuildingchangewindow.c

17>buildguildbuildingwindow.c

17>captchadialog.c

17>changegradenamedialog.c

10>FlyTarget.cpp

17>changelookwindow.c

7>EterLib.vcxproj -> D:\binary_source\vs_files\EterLib\Release\EterLib.lib

10>FlyTrace.cpp

10>GameEventManager.cpp

16>musicInfo.c

16>networkModule.c

10>GameType.cpp

16>new_introcreate.c

10>GameUtil.cpp

10>ItemData.cpp

10>ItemManager.cpp

10>MapBase.cpp

10>MapManager.cpp

10>MapOutdoor.cpp

16>new_introselect.c

10>MapOutdoorCharacterShadow.cpp

10>MapOutdoorIndexBuffer.cpp

10>MapOutdoorLoad.cpp

7>Génération du projet "EterLib.vcxproj" terminée.

17>changepassworddialog.c

17>characterdetailswindow.c

17>characterwindow.c

17>characterwindowbonusstruct.c

17>connectingdialog.c

17>costumewindow.c

17>createcharacterwindow.c

17>cuberenewalwindow.c

17>cuberesultwindow.c

17>cubewindow.c

17>declareguildwardialog.c

16>playerSettingModule.c

17>declareguildwarselectdialog.c

17>dragonsoulattr.c

17>dragonsoulrefinewindow.c

17>dragonsoulwindow.c

17>dungeoninfowindow.c

16>Prototype.c

17>dungeonrankingwindow.c

17>energybar.c

17>equipmentdialog.c

17>exchangedialog.c

17>exchangedialog_new.c

17>expandedmoneytaskbar.c

17>expandedtaskbar.c

17>fishingwindow.c

17>gameoptiondialog.c

17>gameoptiondialog_formobile.c

10>MapOutdoorQuadtree.cpp

16>searchprivateshop_cfg.c

17>gamewindow.c

10>MapOutdoorRender.cpp

17>gayarenewal.c

16>serverCommandParser.c

17>gemshopwindow.c

16>serverInfo.c

10>MapOutdoorRenderHTP.cpp

17>giftbox.c

17>guilddonatedialog.c

16>stringCommander.c

10>MapOutdoorRenderSTP.cpp

16>system.c

16>test_affect.c

10>Génération de code en cours...

16>ui.c

16>uiacce.c

17>guildlanddealdialog.c

17>guildlanddealvotedialog.c

17>guildpopupdialog.c

16>uiAffectShower.c

17>guildresultpopupdialog.c

16>uiantimultiplefarm.c

17>guildvotepopupdialog.c

17>guildvotepopupdialog2.c

17>guildwindow.c

17>guildwindow_baseinfopage.c

17>guildwindow_bcp.c

17>guildwindow_boardpage.c

17>guildwindow_gradepage.c

16>uiAttachMetin.c

17>guildwindow_guildbank.c

17>guildwindow_guildbanklog.c

17>guildwindow_guilddragonlairranking.c

16>uiAuction.c

17>guildwindow_guildinfopage.c

16>uiAutoban.c

17>guildwindow_guildinfopage_eu.c

17>guildwindow_guildinfopage_jp.c

10>Compilation en cours...

10>MapOutdoorUpdate.cpp

16>uibufferinfo.c

17>guildwindow_guildlistwindow.c

16>uiCandidate.c

10>MapOutdoorWater.cpp

16>uicaptcha.c

17>guildwindow_guildrankingwindow.c

10>MapType.cpp

10>MapUtil.cpp

17>guildwindow_guildskillpage.c

10>MonsterAreaInfo.cpp

10>PhysicsObject.cpp

10>Property.cpp

16>uichangelook.c

17>guildwindow_memberpage.c

17>guildwindow_warscoreboard.c

17>helpwindow.c

16>uiCharacter.c

10>PropertyLoader.cpp

17>helpwindow2.c

16>uicharacterdetails.c

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiCharacter.c(63337,45): warning C4146: opérateur moins unaire appliqué à un type non signé, le résultat sera non signé

10>PropertyManager.cpp

17>helpwindownew.c

17>imekor.c

17>inputdialog.c

17>inputdialogofflineshop.c

17>inputdialogshop.c

17>inputdialogwithdescription.c

17>inputdialogwithdescription2.c

17>inventorywindow.c

17>itemcombinationwindow.c

17>keychange_window.c

17>loadingwindow.c

17>loginwindow.c

17>mailbox.c

17>mailboxlist.c

17>maintenancewindow.c

17>mallwindow.c

17>marklistwindow.c

10>RaceData.cpp

17>messengerwindow.c

17>minigameattendance.c

17>minigamecatchkinggamepage.c

10>RaceDataFile.cpp

16>uiChat.c

10>RaceManager.cpp

17>minigamecatchkingsimplewaitingpage.c

17>minigamecatchkingwaitingpage.c

17>minigamedialog.c

10>RaceMotionData.cpp

17>minigamefisheventwaitingpage.c

17>minigamefishgamepage.c

17>minigamerumigamepage.c

17>minigamerumiwaitingpage.c

10>SnowEnvironment.cpp

17>minigamewindow.c

17>minigameyutnorigamepage.c

10>SnowParticle.cpp

10>TerrainDecal.cpp

17>minigameyutnoriwaitingpage.c

17>minimap.c

10>TerrainPatch.cpp

10>TerrainQuadtree.cpp

10>WeaponTrace.cpp

17>moneyinputdialog.c

16>uiCommon.c

10>Génération de code en cours...

17>moneyinputdialognew.c

17>monstercardwindow.c

17>mousebuttonwindow.c

17>movechanneldialog.c

17>musiclistwindow.c

17>myshopdecorationwindow.c

17>newprivateshopsearch.c

17>newprivateshopsearchfilter.c

17>newtaskbar.c

16>uiCube.c

17>new_createcharacterwindow.c

17>new_inventorywindow.c

16>uicuberenewal.c

17>new_selectcharacterwindow.c

16>uidragonlairranking.c

17>offlineshopadminpanel.c

17>offlineshopbuilder.c

17>offlineshopcreatedialog.c

16>uiDragonSoul.c

16>uidungeoninfo.c

17>offlineshopdialog.c

17>offlineshopmanagerdialog.c

16>uiEquipmentDialog.c

16>uiEx.c

10>GameLib.vcxproj -> D:\binary_source\vs_files\GameLib\Release\GameLib.lib

16>uiExchange.c

17>offlineshopsaleswindow.c

17>offlineshop_banka.c

17>offlineshop_bankdialog.c

17>opengiftboxui.c

17>openofflineshopdialog.c

17>overfallnetworkcheck.c

17>partymatchwindow.c

17>partymemberinfoboard.c

17>passworddialog.c

16>uiGameButton.c

17>pethatchingwindow.c

17>petinformationwindow.c

17>petminiinformationwindow.c

17>petnamechangewindow.c

17>picketcdialog.c

16>uiGameOption.c

17>pickmoneydialog.c

17>pickoffshopmoneydialog.c

17>popupdialog.c

16>uigayanew.c

17>popupdialog2.c

17>postread.c

17>postwrite.c

17>privateshopbuilder.c

17>privateshopdialog.c

16>uigemshop.c

17>privateshopsearchdialog.c

17>questdialog.c

16>uigiveitem.c

17>questiondialog.c

17>questiondialog2.c

17>questiondialog_confirmdestroy.c

16>uiGuild.c

17>questiondropdialog.c

17>questiondropdialogitem.c

17>questiondueloptiondialog.c

17>rankingboardwindow.c

16>uiguilddragonlairranking.c

17>refinedialog.c

17>registerchallengewindow.c

17>restartdialog.c

17>rightmousebuttonwindow.c

16>uiHelp.c

17>safeboxwindow.c

17>safeboxwindow_spcinv.c

17>selectattrdialog.c

17>selectcharacterwindow.c

17>selectempirewindow.c

16>uihelp_new.c

10>Génération du projet "GameLib.vcxproj" terminée.

18>------ Début de la regénération globale : Projet : UserInterface, Configuration : Release Win32 ------

16>uiInventory.c

17>selectitemwindow.c

17>shopdialog.c

16>uimailbox.c

17>shopdialog_.c

17>skillbookcombinationdialog.c

17>skillcolorwindow.c

17>skillpointresetdialog.c

17>specialgachawindow.c

17>specialinventorywindow.c

17>systemdialog.c

17>systemdialog_formall.c

17>systemdialog_forportal.c

17>systemoptiondialog.c

17>taskbar.c

17>tradebonuscostume.c

17>usersituationnotice.c

17>weblinkedbannerwindow.c

17>webwindow.c

17>whisperdialog.c

16>uimaintenance.c

17>wndgiveitem.c

16>uiMapNameShower.c

16>uiMessenger.c

18>StdAfx.cpp

16>uiminigame.c

16>uiminigamecatchking.c

16>uiminigamerumi.c

18>D:\binary_source\source\eterLib\SkyBox.h(108,2): warning C5208: la classe sans nom utilisée dans le nom de typedef ne peut pas déclarer de membres qui ne sont pas des membres de données non statiques, des énumérations de membres ou des classes membres

16>uiMiniMap.c

16>uinewoptions.c

18>AccountConnector.cpp

16>uinewprivateshopsearch.c

18>AffectFlagContainer.cpp

18>BadgeNotificationManager.cpp

16>uiofflineshop.c

18>CameraProcedure.cpp

18>CefClientApp.cpp

17>CUiScriptLib.vcxproj -> D:\binary_source\extern\library\uiscriptlib.lib

16>uiofflineshopbuilder.c

18>CefClientHandler.cpp

18>CefClientV8ExtensionHandler.cpp

18>CefWebBrowser.cpp

18>CheckLatestFiles.cpp

18>CPythonRenderTargetModule.cpp

16>uiopengiftbox.c

16>uiOption.c

16>uiParty.c

16>uipartychallenge.c

18>GameType.cpp

18>GuildMarkDownloader.cpp

16>uipetinfo.c

16>uiPhaseCurtain.c

16>uipicketc.c

18>GuildMarkUploader.cpp

16>uiPickMoney.c

16>uiPlayerGauge.c

18>HAntiMultipleFarm.cpp

16>uiPointReset.c

16>uiPrivateShopBuilder.c

16>uiprivateshopsearch.c

18>HTSDK.cpp

18>InstanceBase.cpp

16>uiQuest.c

16>uiquestcategory.c

18>InstanceBaseBattle.cpp

16>uiRefine.c

16>uiRestart.c

16>uiSafebox.c

18>InstanceBaseEffect.cpp

16>uiScriptLocale.c

16>uiselectitem.c

16>uiselectitemex.c

16>uiSelectMusic.c

16>uiShop.c

16>uiskillcolor.c

18>InstanceBaseEvent.cpp

18>InstanceBaseMotion.cpp

16>uispecialinventory.c

16>uiswitchbot.c

18>Génération de code en cours...

16>uiSystem.c

16>uiSystemOption.c

16>uiTarget.c

16>uiTaskBar.c

18>Compilation en cours...

18>InstanceBaseMovement.cpp

16>uiTip.c

18>InstanceBaseTransform.cpp

16>uiToolTip.c

16>uitradebonuscostume.c

16>uiUploadMark.c

18>InsultChecker.cpp

18>Locale.cpp

16>uiWeb.c

16>uiWhisper.c

18>MarkImage.cpp

18>MarkManager.cpp

18>MovieMan.cpp

18>NetworkActorManager.cpp

18>PingManager.cpp

18>ProcessCRC.cpp

18>ProcessScanner.cpp

18>PythonAcce.cpp

18>PythonApplication.cpp

18>PythonApplicationCamera.cpp

18>PythonApplicationCursor.cpp

18>PythonApplicationEvent.cpp

18>PythonApplicationLogo.cpp

18>PythonApplicationModule.cpp

18>PythonApplicationProcedure.cpp

18>PythonApplicationWebPage.cpp

18>Génération de code en cours...

18>Compilation en cours...

18>PythonBackground.cpp

18>PythonBackgroundModule.cpp

18>PythonChangeLook.cpp

18>PythonCharacterManager.cpp

18>PythonCharacterManagerModule.cpp

18>PythonCharacterModule.cpp

18>PythonChat.cpp

18>PythonChatModule.cpp

18>PythonConfig.cpp

18>PythonConfigModule.cpp

18>PythonCubeRenewal.cpp

18>PythonEffectModule.cpp

18>PythonEventManager.cpp

18>PythonEventManagerMoudle.cpp

18>PythonExceptionSender.cpp

18>PythonExchange.cpp

18>PythonExchangeModule.cpp

18>PythonFlyModule.cpp

18>PythonGameEventManagerModule.cpp

18>PythonGuild.cpp

18>Génération de code en cours...

18>Compilation en cours...

18>PythonIME.cpp

18>PythonIMEModule.cpp

18>PythonItem.cpp

18>PythonItemModule.cpp

18>PythonMessenger.cpp

18>PythonMiniMap.cpp

18>PythonMiniMapModule.cpp

18>PythonNetworkStream.cpp

18>PythonNetworkStreamCommand.cpp

18>PythonNetworkStreamEvent.cpp

18>PythonNetworkStreamModule.cpp

18>PythonNetworkStreamPhaseGame.cpp

18>PythonNetworkStreamPhaseGameActor.cpp

16>CRootLib.vcxproj -> D:\binary_source\extern\library\rootlib.lib

18>PythonNetworkStreamPhaseGameItem.cpp

18>PythonNetworkStreamPhaseHandShake.cpp

18>PythonNetworkStreamPhaseLoading.cpp

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\game.c(26407): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\interfaceModule.c(25269): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\item_names_searchshop.c(56685): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\localeInfo.c(31505): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\new_introcreate.c(22590): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\new_introselect.c(22464): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\ui.c(31347): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiCharacter.c(23239): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiChat.c(23678): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiCommon.c(25503): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiDragonSoul.c(22676): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiGuild.c(26090): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiInventory.c(22965): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uimailbox.c(23772): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiMessenger.c(25865): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiminigamecatchking.c(23572): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uinewoptions.c(20632): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uinewprivateshopsearch.c(23736): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiofflineshop.c(22716): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

18>PythonNetworkStreamPhaseLogin.cpp

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uipetinfo.c(23144): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiprivateshopsearch.c(21999): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiQuest.c(22605): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiSafebox.c(23015): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uispecialinventory.c(22227): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiswitchbot.c(22739): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiSystemOption.c(25049): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiTarget.c(22063): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiTaskBar.c(23632): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>D:\binary_source\source\CRootLib\Workplace\RootLib\cyTemp\uiToolTip.c(25567): warning BK4504: le fichier contient trop de rÚfÚrencesá; les rÚfÚrences ultÚrieures provenant de cette source seront ignorÚes

16>Génération du projet "CRootLib.vcxproj" terminée.

18>PythonNetworkStreamPhaseOffline.cpp

18>PythonNetworkStreamPhaseSelect.cpp

18>PythonNewPrivateShopSearch.cpp

18>Génération de code en cours...

18>Compilation en cours...

18>PythonNonPlayer.cpp

18>PythonNonPlayerModule.cpp

18>PythonPackModule.cpp

18>PythonPlayer.cpp

18>PythonPlayerEventHandler.cpp

18>PythonPlayerInput.cpp

18>PythonPlayerInputKeyboard.cpp

18>PythonPlayerInputMouse.cpp

18>PythonPlayerModule.cpp

18>PythonPlayerSettingsModule.cpp

18>PythonPlayerSkill.cpp

18>PythonPrivateShopSearch.cpp

18>PythonProfilerModule.cpp

18>PythonQuest.cpp

18>PythonrootlibManager.cpp

18>PythonSafeBox.cpp

18>PythonShop.cpp

18>PythonSkill.cpp

18>PythonSkillPet.cpp

18>PythonSoundManagerModule.cpp

18>Génération de code en cours...

18>Compilation en cours...

18>PythonSwitchbot.cpp

18>PythonSystem.cpp

18>PythonSystemModule.cpp

18>PythonTextTail.cpp

18>PythonTextTailModule.cpp

18>PythonuiscriptlibManager.cpp

18>ServerStateChecker.cpp

18>ServerStateCheckerModule.cpp

18>UserInterface.cpp

18>Génération de code en cours...

18>minIni.c

18>   Création de la bibliothèque D:\binary_source\binary\Metin2Release.lib et de l'objet D:\binary_source\binary\Metin2Release.exp

18>Génération de code en cours

18>Previous IPDB not found, fall back to full compilation.

18>All 543 functions were compiled because no usable IPDB/IOBJ from previous compilation was found.

18>Fin de la génération du code

18>UserInterface.vcxproj -> D:\binary_source\binary\Metin2Release.exe

18>Génération du projet "UserInterface.vcxproj" terminée.

========== Regénération globale : 18 a réussi, 0 a échoué, 0 a été ignoré ==========

 

Vous pouvez a présent lancer Metin2Release.exe qui se trouve dans : binary_source\binary

 

pour trouver un compte facilement aller sur navicat>mysql>user>Copier le mot de passe du compte que vous avez créer au debut, ensuite aller dans account>account>modifier le 1er account, modifier son mot de passe par le votre et voilà compte : id : ruiiur00 mdp : le votre

(ou sinon créer vous tous simplement un nouveau compte :)

 

Vous pouvez aussi déposer les source server dans votre FTP, mais pas besoin pour l'ouverture 

Bon courage à vous, et essayer de faire avancer le fil.

 

pour corriger l'erreur BSCMAKE BK4504 :

Source erreur BK4504

 

le fichier contient un trop grand nombre de références ; autres références à partir de cette source ignorées

Le fichier. cpp contient plus de 64 000 références de symboles. Lorsque BSCMAKE a rencontré 64 000 références dans un fichier, il ignore toutes les références supplémentaires.

Pour corriger le problème, fractionnez le fichier en deux ou plusieurs fichiers, chacun d’entre eux ayant moins de 64 000 références de symboles

(si quelqu'un saurais les fractionner ou trouver une solution sa serais cool)

Cordialement, Dante

Pourquoi tu ne l’a pas supprimer et ou simplement commenter le BIND_IP ? Tu en as pas besoin si tu es en local.

  • J'adore 3
Link to comment
  • 3 weeks later...
  • 4 weeks later...
  • 2 weeks later...
Le 14/08/2021 à 21:22, Invité Anonymous a dit :

Alguém instalou e resolveu o bug da pedra que está toda no chocolate?

il suffit d'aller à la source binaire pour supprimer les pierres qui ont le mode chocolat chercher le système valentine

Link to comment
  • 2 weeks later...

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!

Register a new account

Sign in

Already have an account? Sign in here.

Sign In Now


Important Information

Terms of Use / Privacy Policy / Guidelines / We have placed cookies on your device to help make this website better. You can adjust your cookie settings, otherwise we'll assume you're okay to continue.